Vulpes lagopus (Arctic fox): 121499929 Help Entry 121499929         CDS       T07435                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg01522   Endocrine resistance vlg01524   Platinum drug resistance vlg04010   MAPK signaling pathway vlg04071   Sphingolipid signaling pathway vlg04110   Cell cycle vlg04115   p53 signaling pathway vlg04137   Mitophagy - animal vlg04151   PI3K-Akt signaling pathway vlg04210   Apoptosis vlg04211   Longevity regulating pathway vlg04216   Ferroptosis vlg04218   Cellular senescence vlg04310   Wnt signaling pathway vlg04722   Neurotrophin signaling pathway vlg04919   Thyroid hormone signaling pathway vlg05012   Parkinson disease vlg05014   Amyotrophic lateral sclerosis vlg05016   Huntington disease vlg05160   Hepatitis C vlg05161   Hepatitis B vlg05162   Measles vlg05163   Human cytomegalovirus infection vlg05165   Human papillomavirus infection vlg05166   Human T-cell leukemia virus 1 infection vlg05167   Kaposi sarcoma-associated herpesvirus infection vlg05168   Herpes simplex virus 1 infection vlg05169   Epstein-Barr virus infection vlg05200   Pathways in cancer vlg05202   Transcriptional misregulation in cancer vlg05203   Viral carcinogenesis vlg05205   Proteoglycans in cancer vlg05206   MicroRNAs in cancer vlg05210   Colorectal cancer vlg05212   Pancreatic cancer vlg05213   Endometrial cancer vlg05214   Glioma vlg05215   Prostate cancer vlg05216   Thyroid cancer vlg05217   Basal cell carcinoma vlg05218   Melanoma vlg05219   Bladder cancer vlg05220   Chronic myeloid leukemia vlg05222   Small cell lung cancer vlg05223   Non-small cell lung cancer vlg05224   Breast cancer vlg05225   Hepatocellular carcinoma vlg05226   Gastric cancer vlg05230   Central carbon metabolism in cancer vlg05417   Lipid and atherosclerosis vlg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121499929 (TP53)    04310 Wnt signaling pathway     121499929 (TP53)    04071 Sphingolipid signaling pathway     121499929 (TP53)    04151 PI3K-Akt signaling pathway     121499929 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     121499929 (TP53)   09143 Cell growth and death    04110 Cell cycle     121499929 (TP53)    04210 Apoptosis     121499929 (TP53)    04216 Ferroptosis     121499929 (TP53)    04115 p53 signaling pathway     121499929 (TP53)    04218 Cellular senescence     121499929 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     121499929 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     121499929 (TP53)   09149 Aging    04211 Longevity regulating pathway     121499929 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121499929 (TP53)    05202 Transcriptional misregulation in cancer     121499929 (TP53)    05206 MicroRNAs in cancer     121499929 (TP53)    05205 Proteoglycans in cancer     121499929 (TP53)    05203 Viral carcinogenesis     121499929 (TP53)    05230 Central carbon metabolism in cancer     121499929 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     121499929 (TP53)    05212 Pancreatic cancer     121499929 (TP53)    05225 Hepatocellular carcinoma     121499929 (TP53)    05226 Gastric cancer     121499929 (TP53)    05214 Glioma     121499929 (TP53)    05216 Thyroid cancer     121499929 (TP53)    05220 Chronic myeloid leukemia     121499929 (TP53)    05217 Basal cell carcinoma     121499929 (TP53)    05218 Melanoma     121499929 (TP53)    05219 Bladder cancer     121499929 (TP53)    05215 Prostate cancer     121499929 (TP53)    05213 Endometrial cancer     121499929 (TP53)    05224 Breast cancer     121499929 (TP53)    05222 Small cell lung cancer     121499929 (TP53)    05223 Non-small cell lung cancer     121499929 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121499929 (TP53)    05161 Hepatitis B     121499929 (TP53)    05160 Hepatitis C     121499929 (TP53)    05162 Measles     121499929 (TP53)    05168 Herpes simplex virus 1 infection     121499929 (TP53)    05163 Human cytomegalovirus infection     121499929 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     121499929 (TP53)    05169 Epstein-Barr virus infection     121499929 (TP53)    05165 Human papillomavirus infection     121499929 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     121499929 (TP53)    05014 Amyotrophic lateral sclerosis     121499929 (TP53)    05016 Huntington disease     121499929 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121499929 (TP53)    05418 Fluid shear stress and atherosclerosis     121499929 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     121499929 (TP53)    01522 Endocrine resistance     121499929 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:vlg03000]     121499929 (TP53)    03036 Chromosome and associated proteins [BR:vlg03036]     121499929 (TP53)    03400 DNA repair and recombination proteins [BR:vlg03400]     121499929 (TP53) Transcription factors [BR:vlg03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     121499929 (TP53) Chromosome and associated proteins [BR:vlg03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      121499929 (TP53) DNA repair and recombination proteins [BR:vlg03400]  Eukaryotic type   Check point factors    Other check point factors     121499929 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  121499929 NCBI-ProteinID:  XP_041627125 LinkDB All DBs Position 10:complement(58940097..58953763) Genome browser AA seq 381 aa AA seqDB search MQEPQSELNIDPPLSQETFSELWNLLPENNVLSSELCPAVDELLLPESVVNWLDEDSDDA PRMPATSAPTAPGPAPSWPLSSFVPSPKTYPGTYGFRLGFLHSGTAKSVTWTYSPLLNKL FCQLAKTCPVQLWVSSPPPPNTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQ HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDYTTIHYNYMCNSSCMGGMNRRPIL TIITLEDSSGNVLGRNSFEVRVCACPGRDRRTEEENFHKKGEPCPEPPPGSTKRALPPST SSSPPQKKKPLDGEYFTLQIRGRERYEMFRNLNEALELKDAQSGKEPGGSRAHSSHLKAK KGQSTSRHKKLMFKREGPDSD NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgcaagagccacagtcagagctcaatatcgacccccctctgagccaggagactttttca gaattgtggaacctgcttcctgaaaacaatgttctgtcttctgagctgtgcccagcagtg gatgagctgctgctcccagaaagcgtcgtgaactggctagacgaagactcagatgatgct cccaggatgccagccacttctgcccccacagcccctggaccggccccctcctggccccta tcatcctttgtcccttccccgaagacctaccctggcacctatgggttccgtttggggttc ctgcattctgggacagccaagtctgttacttggacgtactcccctctcctcaacaagctg ttttgccagctggcgaagacctgccccgtgcaactgtgggtcagctccccacccccaccc aacacctgtgtccgcgctatggccatctataagaagtcggagttcgtgaccgaggttgtg cggcgctgcccccaccatgaacgctgctctgacagtagtgacggtcttgcccctcctcag catctcatccgagtggaaggaaatttgcgggccaagtacctggatgacagaaacactttt cggcacagcgtggtggtgccttatgagccacccgaggttggctctgactataccaccatc cactacaactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc accatcatcaccctggaagactccagtggaaacgtgctgggacggaacagctttgaggta cgcgtttgtgcctgtcccgggagagaccgccggactgaggaggagaatttccacaagaag ggggagccttgtcctgagccaccccccgggagtaccaagcgagcactgcctcccagcacc agctcctctcccccgcaaaagaagaagccactggatggagaatatttcacccttcagatc cgggggcgtgaacgctatgagatgttcaggaatctgaatgaagccttggagctgaaggat gcccagagtggaaaggagccggggggaagcagggctcactccagccacctgaaggcaaag aaggggcaatctacctctcgccataaaaaactgatgttcaagagagaagggcccgactca gactga

DBGET integrated database retrieval system