Vidua macroura (Pin-tailed whydah): 128807264 Help Entry 128807264         CDS       T11570                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism vmc  Vidua macroura (Pin-tailed whydah) Pathway vmc04010   MAPK signaling pathway vmc04510   Focal adhesion vmc04517   IgSF CAM signaling vmc04520   Adherens junction Brite KEGG Orthology (KO) [BR:vmc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128807264 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     128807264 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     128807264 (RAP1B)    04520 Adherens junction     128807264 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vmc04147]     128807264 (RAP1B)    04031 GTP-binding proteins [BR:vmc04031]     128807264 (RAP1B) Exosome [BR:vmc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128807264 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    128807264 (RAP1B)   Exosomal proteins of colorectal cancer cells    128807264 (RAP1B) GTP-binding proteins [BR:vmc04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     128807264 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  128807264 NCBI-ProteinID:  XP_053833481 LinkDB All DBs Position 5:complement(39389383..39420568) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatacaagctagtggttcttggttctggaggtgttggaaagtctgctctgact gtacagtttgttcaaggaatatttgttgaaaaatacgatcctacgatagaggactcctac agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttagatactgcagga acggaacagtttacagcgatgagagatctatacatgaaaaatggacaaggttttgcatta gtatattctatcacagctcagtccacatttaatgatttacaggatctaagagaacagatt cttcgagtcaaagacactgatgacgtgcctatgattctggttggcaataagtgtgacttg gaagatgaaagagttgtgggaaaggaacaaggtcagaacctagcaaggcaatggaataac tgtgcattcttagagtcttctgcaaaatcaaagataaatgttaatgagatcttttatgac cttgtgcgacaaattaacagaaaaactccggtgcctggaaaagcacgcaaaaagtcatcg tgtcagctactttaa

DBGET integrated database retrieval system