Vidua macroura (Pin-tailed whydah): 128807555 Help Entry 128807555         CDS       T11570                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism vmc  Vidua macroura (Pin-tailed whydah) Pathway vmc03050   Proteasome vmc04060   Cytokine-cytokine receptor interaction vmc04217   Necroptosis vmc04350   TGF-beta signaling pathway vmc05164   Influenza A vmc05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:vmc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     128807555 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     128807555 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128807555 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128807555 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     128807555 (IFNG)    05168 Herpes simplex virus 1 infection     128807555 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:vmc03051]     128807555 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vmc04052]     128807555 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:vmc00536]     128807555 (IFNG) Proteasome [BR:vmc03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     128807555 (IFNG) Cytokines and neuropeptides [BR:vmc04052]  Cytokines   Interferons    128807555 (IFNG) Glycosaminoglycan binding proteins [BR:vmc00536]  Heparan sulfate / Heparin   Cytokines    128807555 (IFNG) SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma Fib_alpha DUF948 Lipoprotein_20 LETM1_C Sec8_N Phage_scaffold GFP ATG14 IL31 ADIP RHA1_ro05818_N HBM CG4951_N RHG29_45_N TMEM120A-B FapA Motif Other DBs NCBI-GeneID:  128807555 NCBI-ProteinID:  XP_053834002 UniProt:  A0A852EEP5 LinkDB All DBs Position 5:39566620..39570053 Genome browser AA seq 165 aa AA seqDB search MAFQTYSLFVLSVIMISFGHVENRLNLLQLQNDIDKLKADFNSSHSDVADGGPIFTERLS SWTERNEKRIILSQIISMYLKMLENTDRSKAHVRNIAEELHTLKESLTDGSKKIEDLKDL TKLQMSDLKVQRKAVNELFSVLQKLGDTSSSHKRKRSQFQRLCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggctttccaaacctacagcttgtttgttctgtctgtcatcatgatttcttttggacat gttgaaaatagattgaatcttcttcaacttcaaaatgatatagacaaactgaaagctgat ttcaactcaagtcattctgatgtagctgatggtggacctatttttacggaaaggctgtca agctggacagagagaaatgaaaaaaggatcatcctgagtcagattatttccatgtacttg aaaatgcttgaaaacactgacaggtcaaaggctcatgtcaggaacatagctgaggagctc catactctgaaagaaagccttactgatggctcaaagaagatagaagatctcaaggacctg acaaaactgcagatgagtgacttgaaagttcagcgcaaggccgtaaatgagctgttcagt gtcttacaaaaactgggggatacctcaagttctcacaaaagaaaaagaagccagtttcag aggctgtgcaaatgctaa

DBGET integrated database retrieval system