KEGG   Vpept: 155348-2
Entry
155348-2          CDS       T49000                                 
Symbol
PR
Name
(KEGG) HIV-1 protease
  KO
K22599  HIV protease [EC:3.4.23.16 3.4.23.47]
Virus
11676  Human immunodeficiency virus 1
SSDB
Motif
Pfam: RVP gag-asp_proteas Asp_protease_2
Other DBs
NCBI-ProteinID: NP_705926 NP_057849
GB: NC_001802
LinkDB
AA seq 99 aa
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Comment
vg:155348 489..587

DBGET integrated database retrieval system