KEGG   Vpept: 155348-3
Entry
155348-3          CDS       T49000                                 

Gene name
p66, p51
Definition
(KEGG) HIV-1 reverse transcriptase/ribonuclease H
  KO
K24802  HIV-1 reverse transcriptase / ribonuclease H [EC:2.7.7.49 2.7.7.7 3.1.26.13]
Taxonomy
TAX:11676 [GN:T40001]
  Lineage
Viruses; ssRNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Organism
vp  Virus mature peptides
SSDB
Motif
Pfam: RVT_connect RVT_1 RNase_H RVT_thumb LPD16 Hydrolase
Other DBs
NCBI-ProteinID: NP_705927 NP_057849
GB: NC_001802
LinkDB
AA seq 560 aa
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL
Comment
vg:155348 588..1147

DBGET integrated database retrieval system