KEGG   Vpept: 43740578-6
Entry
43740578-6        CDS       T49000                                 

Symbol
nsp6
Name
(KEGG) SARS-CoV-2 non-structural protein 6
  KO
K25016  SARS coronavirus non-structural protein 6
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vp  Virus mature peptides
SSDB
Motif
Pfam: CoV_NSP6 TM1506
Other DBs
NCBI-ProteinID: YP_009724389
GB: NC_045512
LinkDB
AA seq 290 aa
SAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFV
KHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAV
VLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVT
TVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLG
VYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ
Comment
vg:43740578 3570..3859

DBGET integrated database retrieval system