Vicugna pacos (alpaca): 102527650 Help Entry 102527650         CDS       T08098                                  Name (RefSeq) actin, cytoplasmic 1-like   KO K05692   actin beta/gamma 1 Organism vpc  Vicugna pacos (alpaca) Pathway vpc03082   ATP-dependent chromatin remodeling vpc04015   Rap1 signaling pathway vpc04145   Phagosome vpc04210   Apoptosis vpc04390   Hippo signaling pathway vpc04510   Focal adhesion vpc04517   IgSF CAM signaling vpc04518   Integrin signaling vpc04520   Adherens junction vpc04530   Tight junction vpc04611   Platelet activation vpc04613   Neutrophil extracellular trap formation vpc04670   Leukocyte transendothelial migration vpc04714   Thermogenesis vpc04810   Regulation of actin cytoskeleton vpc04814   Motor proteins vpc04820   Cytoskeleton in muscle cells vpc04919   Thyroid hormone signaling pathway vpc04921   Oxytocin signaling pathway vpc04971   Gastric acid secretion vpc05014   Amyotrophic lateral sclerosis vpc05100   Bacterial invasion of epithelial cells vpc05132   Salmonella infection vpc05135   Yersinia infection vpc05164   Influenza A vpc05205   Proteoglycans in cancer vpc05225   Hepatocellular carcinoma vpc05410   Hypertrophic cardiomyopathy vpc05412   Arrhythmogenic right ventricular cardiomyopathy vpc05414   Dilated cardiomyopathy vpc05416   Viral myocarditis vpc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102527650  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102527650    04390 Hippo signaling pathway     102527650   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102527650    04518 Integrin signaling     102527650  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102527650   09143 Cell growth and death    04210 Apoptosis     102527650   09144 Cellular community - eukaryotes    04510 Focal adhesion     102527650    04520 Adherens junction     102527650    04530 Tight junction     102527650   09142 Cell motility    04814 Motor proteins     102527650    04820 Cytoskeleton in muscle cells     102527650    04810 Regulation of actin cytoskeleton     102527650  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102527650    04613 Neutrophil extracellular trap formation     102527650    04670 Leukocyte transendothelial migration     102527650   09152 Endocrine system    04921 Oxytocin signaling pathway     102527650    04919 Thyroid hormone signaling pathway     102527650   09154 Digestive system    04971 Gastric acid secretion     102527650   09159 Environmental adaptation    04714 Thermogenesis     102527650  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102527650   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102527650   09172 Infectious disease: viral    05164 Influenza A     102527650   09171 Infectious disease: bacterial    05132 Salmonella infection     102527650    05135 Yersinia infection     102527650    05100 Bacterial invasion of epithelial cells     102527650   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102527650   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102527650    05410 Hypertrophic cardiomyopathy     102527650    05412 Arrhythmogenic right ventricular cardiomyopathy     102527650    05414 Dilated cardiomyopathy     102527650    05416 Viral myocarditis     102527650  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:vpc03021]     102527650    03019 Messenger RNA biogenesis [BR:vpc03019]     102527650    03036 Chromosome and associated proteins [BR:vpc03036]     102527650    03029 Mitochondrial biogenesis [BR:vpc03029]     102527650   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vpc04812]     102527650    04147 Exosome [BR:vpc04147]     102527650 Transcription machinery [BR:vpc03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      102527650 Messenger RNA biogenesis [BR:vpc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102527650 Chromosome and associated proteins [BR:vpc03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      102527650     NuA4 complex      102527650   Chromatin remodeling factors    BAF complex     102527650    PBAF complex     102527650    GBAF(ncBAF) complex     102527650    SWR1 complex     102527650 Mitochondrial biogenesis [BR:vpc03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     102527650 Cytoskeleton proteins [BR:vpc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      102527650 Exosome [BR:vpc04147]  Exosomal proteins   Proteins found in most exosomes    102527650 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  102527650 NCBI-ProteinID:  XP_015107812 LinkDB All DBs Position Unknown AA seq 338 aa AA seqDB search MGNDIAALVVDSGSSMCKAGFAGDDAPRAIFPSIMGRPRYQGVMVGTGQKDSYLGDEAQS KRGILTLKYPIEHGIVTNWDDMEKICHHTFYNELRVAPEEHPMLLTEAPLSPKVNCEKMT QIMSEAFNTPAMYVAIQAVLSLYTSGCTTGIVVDSGDGVTHTVPTYEGYALPHTILHLDL AGWDLTDYIMKILTERGYRFTTTAEWEIVHDIKEKPCYITLDLQEMAAAASSSCLEKSYE LPDGQVITVGSERFCCPEALFQPTFLGLEACGIHETTLNSIMKCDVDIRKDLYTNTVLSG GTTIYPGITSRMQKELTALAPSMVKVKIIVTPELKYSM NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt atgggtaatgacattgctgcgcttgtggtcgacagtggctccagcatgtgcaaggctggc tttgcaggcgatgatgccccccgggccatctttccctccatcatgggacgcccacggtac cagggcgtcatggtgggcacgggccagaaagactcctacttgggtgatgaggcccagagc aagagaggcatcctgaccctcaagtaccccattgagcatggcattgtcaccaactgggac gacatggagaagatctgtcaccacaccttctataatgagctacgtgtggcccctgaggag caccccatgctcctgactgaggcccccctgagccccaaggtgaactgtgagaagatgacc cagatcatgtctgaggccttcaacaccccagccatgtacgtggccatccaggccgtgctg tccctgtacacctctggctgcaccactggcattgtggtggactctggtgatggagtcact cacactgtgcccacctatgaagggtatgccctcccccacaccatcctgcatctggacctg gctggctgggacctgacagactacatcatgaagatcctcacggagcgtggctacaggttc accaccacagccgagtgggagatcgtgcatgacatcaaggagaagccctgctacatcacc ctggacttgcaggagatggccgccgccgcctccagctcctgcctggagaagagctatgag ctgcccgatggtcaggtcatcaccgtcggcagcgagcgcttctgctgccccgaggctctc ttccagcccactttcctgggcctggaagcctgtggcatccacgagactaccctcaactcc atcatgaagtgtgatgtggacatccgcaaggacctctacaccaacacggtgctgtctggc gggaccaccatctaccccggcatcaccagcaggatgcagaaggagctcaccgccctggcc cccagcatggtgaaggtcaagatcatcgtgacccccgagctcaagtactccatgtaa

DBGET integrated database retrieval system