Vicugna pacos (alpaca): 102530959 Help Entry 102530959         CDS       T08098                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism vpc  Vicugna pacos (alpaca) Pathway vpc01522   Endocrine resistance vpc01524   Platinum drug resistance vpc04010   MAPK signaling pathway vpc04071   Sphingolipid signaling pathway vpc04110   Cell cycle vpc04115   p53 signaling pathway vpc04137   Mitophagy - animal vpc04151   PI3K-Akt signaling pathway vpc04210   Apoptosis vpc04211   Longevity regulating pathway vpc04216   Ferroptosis vpc04218   Cellular senescence vpc04310   Wnt signaling pathway vpc04722   Neurotrophin signaling pathway vpc04919   Thyroid hormone signaling pathway vpc05012   Parkinson disease vpc05014   Amyotrophic lateral sclerosis vpc05016   Huntington disease vpc05160   Hepatitis C vpc05161   Hepatitis B vpc05162   Measles vpc05163   Human cytomegalovirus infection vpc05165   Human papillomavirus infection vpc05166   Human T-cell leukemia virus 1 infection vpc05167   Kaposi sarcoma-associated herpesvirus infection vpc05168   Herpes simplex virus 1 infection vpc05169   Epstein-Barr virus infection vpc05200   Pathways in cancer vpc05202   Transcriptional misregulation in cancer vpc05203   Viral carcinogenesis vpc05205   Proteoglycans in cancer vpc05206   MicroRNAs in cancer vpc05210   Colorectal cancer vpc05212   Pancreatic cancer vpc05213   Endometrial cancer vpc05214   Glioma vpc05215   Prostate cancer vpc05216   Thyroid cancer vpc05217   Basal cell carcinoma vpc05218   Melanoma vpc05219   Bladder cancer vpc05220   Chronic myeloid leukemia vpc05222   Small cell lung cancer vpc05223   Non-small cell lung cancer vpc05224   Breast cancer vpc05225   Hepatocellular carcinoma vpc05226   Gastric cancer vpc05230   Central carbon metabolism in cancer vpc05417   Lipid and atherosclerosis vpc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102530959 (TP53)    04310 Wnt signaling pathway     102530959 (TP53)    04071 Sphingolipid signaling pathway     102530959 (TP53)    04151 PI3K-Akt signaling pathway     102530959 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102530959 (TP53)   09143 Cell growth and death    04110 Cell cycle     102530959 (TP53)    04210 Apoptosis     102530959 (TP53)    04216 Ferroptosis     102530959 (TP53)    04115 p53 signaling pathway     102530959 (TP53)    04218 Cellular senescence     102530959 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     102530959 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     102530959 (TP53)   09149 Aging    04211 Longevity regulating pathway     102530959 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102530959 (TP53)    05202 Transcriptional misregulation in cancer     102530959 (TP53)    05206 MicroRNAs in cancer     102530959 (TP53)    05205 Proteoglycans in cancer     102530959 (TP53)    05203 Viral carcinogenesis     102530959 (TP53)    05230 Central carbon metabolism in cancer     102530959 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     102530959 (TP53)    05212 Pancreatic cancer     102530959 (TP53)    05225 Hepatocellular carcinoma     102530959 (TP53)    05226 Gastric cancer     102530959 (TP53)    05214 Glioma     102530959 (TP53)    05216 Thyroid cancer     102530959 (TP53)    05220 Chronic myeloid leukemia     102530959 (TP53)    05217 Basal cell carcinoma     102530959 (TP53)    05218 Melanoma     102530959 (TP53)    05219 Bladder cancer     102530959 (TP53)    05215 Prostate cancer     102530959 (TP53)    05213 Endometrial cancer     102530959 (TP53)    05224 Breast cancer     102530959 (TP53)    05222 Small cell lung cancer     102530959 (TP53)    05223 Non-small cell lung cancer     102530959 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102530959 (TP53)    05161 Hepatitis B     102530959 (TP53)    05160 Hepatitis C     102530959 (TP53)    05162 Measles     102530959 (TP53)    05168 Herpes simplex virus 1 infection     102530959 (TP53)    05163 Human cytomegalovirus infection     102530959 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     102530959 (TP53)    05169 Epstein-Barr virus infection     102530959 (TP53)    05165 Human papillomavirus infection     102530959 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     102530959 (TP53)    05014 Amyotrophic lateral sclerosis     102530959 (TP53)    05016 Huntington disease     102530959 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102530959 (TP53)    05418 Fluid shear stress and atherosclerosis     102530959 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102530959 (TP53)    01522 Endocrine resistance     102530959 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:vpc03000]     102530959 (TP53)    03036 Chromosome and associated proteins [BR:vpc03036]     102530959 (TP53)    03400 DNA repair and recombination proteins [BR:vpc03400]     102530959 (TP53) Transcription factors [BR:vpc03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     102530959 (TP53) Chromosome and associated proteins [BR:vpc03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      102530959 (TP53) DNA repair and recombination proteins [BR:vpc03400]  Eukaryotic type   Check point factors    Other check point factors     102530959 (TP53) SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD TAD2 Se-cys_synth_N Motif Other DBs NCBI-GeneID:  102530959 NCBI-ProteinID:  XP_006218839 UniProt:  A0A6I9IU13 LinkDB All DBs Position Unknown AA seq 381 aa AA seqDB search MEESQSELGVEPPLSQETFSDLWKLLPENNLLSSEFSPAVDELLLSPEVTNWLDENPDEA PRMQEPPVPTASAPATSWPLSSFVPSQKTYPGSYGFRLGFLHSGTAKSVTCTYSPPLNKL FCQLAKTCPVQLWVSSLPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERSSDYSDGLAPPQ HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRRPIL TIITLEDASGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQPCPELPPGSTKRALPTSS SSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGENKAHSSHLKSK KGQSPSRHKKLMFKREGPDSD NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atggaggagtcgcaatcagaactcggcgtggagccccctctgagtcaggagacgttttca gacttgtggaaactactacctgaaaacaaccttctgtcctccgagttctccccggcagtg gatgaactactcctgtccccagaagttaccaactggttggatgagaatccagatgaagcc ccaagaatgcaagagcctcctgtccccactgcctccgcaccagccacctcctggcccctg tcatcctttgtcccttcccagaagacctaccctggcagctacggtttccgtcttgggttc ctgcattctgggacagccaagtctgtaacctgcacgtactcccctcccctcaacaagctg ttttgccagctggccaagacctgcccggtgcagctgtgggtcagctccctgcccccaccc ggcacccgggtccgcgccatggccatctacaagaagtcagagtacatgacggaggttgtg agacgctgcccccaccacgagcgcagttctgactacagcgatggtctcgcccctcctcag catcttatccgggtggaagggaatttacgtgccaagtatttggatgacagaaacactttt cgacacagtgtggtggtgccctacgaaccgccggaggtcggctctgactgtaccactatc cactacaacttcatgtgtaacagctcctgcatggggggcatgaaccggcgacccatcctc accatcatcacactggaggacgccagtggtaatctgctgggacgcaacagctttgaggtg cgtgtttgtgcctgtcctgggagagaccgccgcacagaagaagaaaatttccgcaagaag gggcagccttgccctgagctgccccctgggagcactaagcgagcactgcctaccagcagc agctcctctccaccacaaaagaagaagccgctggatggagaatatttcactcttcagatc cgcgggcgtgaacgttttgagatgttccgggagctgaatgaggccttggagctgaaggat gctcaggctggaaaggagccaggggaaaacaaggctcactctagccacctgaagtctaag aaggggcagtctccctcccgccataaaaaactgatgttcaagagagaagggcctgactca gactga

DBGET integrated database retrieval system