Vicugna pacos (alpaca): 102533186 Help Entry 102533186         CDS       T08098                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism vpc  Vicugna pacos (alpaca) Pathway vpc01522   Endocrine resistance vpc04010   MAPK signaling pathway vpc04024   cAMP signaling pathway vpc04210   Apoptosis vpc04380   Osteoclast differentiation vpc04620   Toll-like receptor signaling pathway vpc04657   IL-17 signaling pathway vpc04658   Th1 and Th2 cell differentiation vpc04659   Th17 cell differentiation vpc04660   T cell receptor signaling pathway vpc04662   B cell receptor signaling pathway vpc04668   TNF signaling pathway vpc04713   Circadian entrainment vpc04725   Cholinergic synapse vpc04728   Dopaminergic synapse vpc04915   Estrogen signaling pathway vpc04917   Prolactin signaling pathway vpc04921   Oxytocin signaling pathway vpc04926   Relaxin signaling pathway vpc04928   Parathyroid hormone synthesis, secretion and action vpc04932   Non-alcoholic fatty liver disease vpc04935   Growth hormone synthesis, secretion and action vpc05031   Amphetamine addiction vpc05132   Salmonella infection vpc05133   Pertussis vpc05135   Yersinia infection vpc05140   Leishmaniasis vpc05142   Chagas disease vpc05161   Hepatitis B vpc05162   Measles vpc05166   Human T-cell leukemia virus 1 infection vpc05167   Kaposi sarcoma-associated herpesvirus infection vpc05170   Human immunodeficiency virus 1 infection vpc05171   Coronavirus disease - COVID-19 vpc05200   Pathways in cancer vpc05207   Chemical carcinogenesis - receptor activation vpc05208   Chemical carcinogenesis - reactive oxygen species vpc05210   Colorectal cancer vpc05224   Breast cancer vpc05231   Choline metabolism in cancer vpc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer vpc05323   Rheumatoid arthritis vpc05417   Lipid and atherosclerosis vpc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102533186 (FOS)    04668 TNF signaling pathway     102533186 (FOS)    04024 cAMP signaling pathway     102533186 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102533186 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102533186 (FOS)    04660 T cell receptor signaling pathway     102533186 (FOS)    04658 Th1 and Th2 cell differentiation     102533186 (FOS)    04659 Th17 cell differentiation     102533186 (FOS)    04657 IL-17 signaling pathway     102533186 (FOS)    04662 B cell receptor signaling pathway     102533186 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     102533186 (FOS)    04917 Prolactin signaling pathway     102533186 (FOS)    04921 Oxytocin signaling pathway     102533186 (FOS)    04926 Relaxin signaling pathway     102533186 (FOS)    04935 Growth hormone synthesis, secretion and action     102533186 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     102533186 (FOS)   09156 Nervous system    04725 Cholinergic synapse     102533186 (FOS)    04728 Dopaminergic synapse     102533186 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     102533186 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     102533186 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102533186 (FOS)    05207 Chemical carcinogenesis - receptor activation     102533186 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     102533186 (FOS)    05231 Choline metabolism in cancer     102533186 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102533186 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     102533186 (FOS)    05224 Breast cancer     102533186 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102533186 (FOS)    05170 Human immunodeficiency virus 1 infection     102533186 (FOS)    05161 Hepatitis B     102533186 (FOS)    05171 Coronavirus disease - COVID-19     102533186 (FOS)    05162 Measles     102533186 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     102533186 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102533186 (FOS)    05135 Yersinia infection     102533186 (FOS)    05133 Pertussis     102533186 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102533186 (FOS)    05142 Chagas disease     102533186 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     102533186 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     102533186 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102533186 (FOS)    05418 Fluid shear stress and atherosclerosis     102533186 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102533186 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102533186 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:vpc03000]     102533186 (FOS)    04131 Membrane trafficking [BR:vpc04131]     102533186 (FOS) Transcription factors [BR:vpc03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     102533186 (FOS) Membrane trafficking [BR:vpc04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102533186 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  102533186 NCBI-ProteinID:  XP_006206148 UniProt:  A0A6I9I9P5 LinkDB All DBs Position 6 AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSTGAYPRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPAKSSSSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPIATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctccggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggatttctgtaccgatctggccgtctccagtgccaacttc atcccaacagtgactgccatctcgaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcccagaccagagctccccacccctatggagtccccact ccctcgactggggcttaccccagggctggagtcgtgaagactatgacaggaggcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacacactccaagcggaaacagaccaattagaagatgagaagtccgctttgcag actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcat cgacctgcctgcaagatccctgatgacctgggtttcccagaagagatgtctgtggcttcc cttgatctgagtgggggcctgcctgaggctgccaccccggaatccgaggaggccttcacc ctgcccctcctcaatgaccctgagcccaagccctcagtggagcccgccaagagctccagc agcatggagctgaaggccgagccctttgatgacttcttgttcccagcatcgtccaggccc agcggctctgagaccgcgcgttctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggttccctggggatggggcccatagccacagagctg gagcccctgtgcaccccagtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtctttacctaccccgaggctgactccttccccagctgtgcagctgctcaccgcaag ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system