Vicugna pacos (alpaca): 102534412 Help Entry 102534412         CDS       T08098                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism vpc  Vicugna pacos (alpaca) Pathway vpc03050   Proteasome vpc04060   Cytokine-cytokine receptor interaction vpc04066   HIF-1 signaling pathway vpc04217   Necroptosis vpc04350   TGF-beta signaling pathway vpc04380   Osteoclast differentiation vpc04612   Antigen processing and presentation vpc04630   JAK-STAT signaling pathway vpc04650   Natural killer cell mediated cytotoxicity vpc04657   IL-17 signaling pathway vpc04658   Th1 and Th2 cell differentiation vpc04659   Th17 cell differentiation vpc04660   T cell receptor signaling pathway vpc04940   Type I diabetes mellitus vpc05140   Leishmaniasis vpc05142   Chagas disease vpc05143   African trypanosomiasis vpc05144   Malaria vpc05145   Toxoplasmosis vpc05146   Amoebiasis vpc05152   Tuberculosis vpc05160   Hepatitis C vpc05164   Influenza A vpc05168   Herpes simplex virus 1 infection vpc05200   Pathways in cancer vpc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer vpc05321   Inflammatory bowel disease vpc05322   Systemic lupus erythematosus vpc05323   Rheumatoid arthritis vpc05330   Allograft rejection vpc05332   Graft-versus-host disease vpc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     102534412 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     102534412 (IFNG)    04630 JAK-STAT signaling pathway     102534412 (IFNG)    04066 HIF-1 signaling pathway     102534412 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102534412 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102534412 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102534412 (IFNG)    04612 Antigen processing and presentation     102534412 (IFNG)    04660 T cell receptor signaling pathway     102534412 (IFNG)    04658 Th1 and Th2 cell differentiation     102534412 (IFNG)    04659 Th17 cell differentiation     102534412 (IFNG)    04657 IL-17 signaling pathway     102534412 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     102534412 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102534412 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102534412 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     102534412 (IFNG)    05164 Influenza A     102534412 (IFNG)    05168 Herpes simplex virus 1 infection     102534412 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     102534412 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     102534412 (IFNG)    05144 Malaria     102534412 (IFNG)    05145 Toxoplasmosis     102534412 (IFNG)    05140 Leishmaniasis     102534412 (IFNG)    05142 Chagas disease     102534412 (IFNG)    05143 African trypanosomiasis     102534412 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     102534412 (IFNG)    05323 Rheumatoid arthritis     102534412 (IFNG)    05321 Inflammatory bowel disease     102534412 (IFNG)    05330 Allograft rejection     102534412 (IFNG)    05332 Graft-versus-host disease     102534412 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102534412 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102534412 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:vpc03051]     102534412 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102534412 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:vpc00536]     102534412 (IFNG) Proteasome [BR:vpc03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     102534412 (IFNG) Cytokines and neuropeptides [BR:vpc04052]  Cytokines   Interferons    102534412 (IFNG) Glycosaminoglycan binding proteins [BR:vpc00536]  Heparan sulfate / Heparin   Cytokines    102534412 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma API5 rva_4 DUF4661 Motif Other DBs NCBI-GeneID:  102534412 NCBI-ProteinID:  XP_006205897 UniProt:  A0A6I9IAZ2 LinkDB All DBs Position 12 AA seq 166 aa AA seqDB search MNYTSYILAFQLCVILGSSGCYCQAPFFDEIENLKKYFNASHPDVADGGPLFLEILKNWK EESDKKIIQSQIVSFYFKLFENLKDNQIIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ IPVDNLKVQRKAISELIKVMNDLSPKSNLRKRKRRQNLIQGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagttatattttggcttttcagctttgcgtgatcttgggttcttctggt tgttactgccaggccccattttttgatgaaatagaaaacctaaagaaatattttaatgca agtcatccagatgtagcagatggtgggcctcttttcttagaaattttgaagaattggaaa gaggagagtgacaaaaaaataattcagagtcagattgtctccttctacttcaaactcttt gaaaacttaaaagataaccagatcattcaaaggagcatggatatcatcaagcaagacatg tttcagaagttcttaaatggcagctctgagaaactagaggacttcaaaaagctgattcaa attccggttgataacctgaaggtccagcgcaaagccataagtgaactcatcaaagtgatg aatgatctgtcaccaaaatctaacctaagaaagcggaagagacgtcagaatctgattcaa ggccggagagcgtcgaagtaa

DBGET integrated database retrieval system