Vicugna pacos (alpaca): 102536146 Help Entry 102536146         CDS       T08098                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism vpc  Vicugna pacos (alpaca) Pathway vpc01521   EGFR tyrosine kinase inhibitor resistance vpc04010   MAPK signaling pathway vpc04014   Ras signaling pathway vpc04015   Rap1 signaling pathway vpc04020   Calcium signaling pathway vpc04151   PI3K-Akt signaling pathway vpc04550   Signaling pathways regulating pluripotency of stem cells vpc04810   Regulation of actin cytoskeleton vpc05167   Kaposi sarcoma-associated herpesvirus infection vpc05200   Pathways in cancer vpc05205   Proteoglycans in cancer vpc05207   Chemical carcinogenesis - receptor activation vpc05218   Melanoma vpc05224   Breast cancer vpc05226   Gastric cancer Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102536146 (FGF2)    04014 Ras signaling pathway     102536146 (FGF2)    04015 Rap1 signaling pathway     102536146 (FGF2)    04020 Calcium signaling pathway     102536146 (FGF2)    04151 PI3K-Akt signaling pathway     102536146 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102536146 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102536146 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102536146 (FGF2)    05205 Proteoglycans in cancer     102536146 (FGF2)    05207 Chemical carcinogenesis - receptor activation     102536146 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     102536146 (FGF2)    05218 Melanoma     102536146 (FGF2)    05224 Breast cancer     102536146 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     102536146 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102536146 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102536146 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:vpc00536]     102536146 (FGF2) Cytokines and neuropeptides [BR:vpc04052]  Cytokines   Growth factors (RTK binding)    102536146 (FGF2) Glycosaminoglycan binding proteins [BR:vpc00536]  Heparan sulfate / Heparin   Growth factors/receptors    102536146 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF IL1 Fascin Motif Other DBs NCBI-GeneID:  102536146 NCBI-ProteinID:  XP_031547565 UniProt:  A0A6J3BKG4 LinkDB All DBs Position 2 AA seq 163 aa AA seqDB search MFLKCRYSLSSVSTGSPSADTRGRLGYAIFHEELEPPRMLISARDAGISPLCIPREECTS ERKCELNFKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNY NTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgtttctaaaatgcagatacagtctgtcttcggtatccacgggttccccatctgcggat acgaggggcagactgggctacgccattttccatgaggagcttgagcctccacggatgctg atatctgctagggatgctggaatcagtcccctctgcatacccagggaggagtgtacctct gaaaggaagtgtgaattaaatttcaaactacaacttcaagcagaagagagaggggtcgtg tctatcaaaggagtgtgtgcaaaccgttaccttgctatgaaggaagatggaagattactg gcttctaaatgtgtcacagacgagtgtttcttttttgaacgattggaatctaataactac aatacttaccggtcaaggaaatactccagttggtatgtggcactgaaacgaactgggcag tacaaacttggacccaaaacaggacctgggcagaaagctatacttttccttccaatgtct gctaagagctga

DBGET integrated database retrieval system