Vicugna pacos (alpaca): 102540243 Help Entry 102540243         CDS       T08098                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism vpc  Vicugna pacos (alpaca) Pathway vpc04060   Cytokine-cytokine receptor interaction vpc04151   PI3K-Akt signaling pathway vpc04217   Necroptosis vpc04380   Osteoclast differentiation vpc04620   Toll-like receptor signaling pathway vpc04621   NOD-like receptor signaling pathway vpc04622   RIG-I-like receptor signaling pathway vpc04623   Cytosolic DNA-sensing pathway vpc04630   JAK-STAT signaling pathway vpc04650   Natural killer cell mediated cytotoxicity vpc04668   TNF signaling pathway vpc04936   Alcoholic liver disease vpc05135   Yersinia infection vpc05142   Chagas disease vpc05152   Tuberculosis vpc05160   Hepatitis C vpc05161   Hepatitis B vpc05162   Measles vpc05163   Human cytomegalovirus infection vpc05164   Influenza A vpc05165   Human papillomavirus infection vpc05167   Kaposi sarcoma-associated herpesvirus infection vpc05168   Herpes simplex virus 1 infection vpc05169   Epstein-Barr virus infection vpc05170   Human immunodeficiency virus 1 infection vpc05171   Coronavirus disease - COVID-19 vpc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102540243 (IFNB1)    04668 TNF signaling pathway     102540243 (IFNB1)    04151 PI3K-Akt signaling pathway     102540243 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102540243 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102540243 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102540243 (IFNB1)    04621 NOD-like receptor signaling pathway     102540243 (IFNB1)    04622 RIG-I-like receptor signaling pathway     102540243 (IFNB1)    04623 Cytosolic DNA-sensing pathway     102540243 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     102540243 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     102540243 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102540243 (IFNB1)    05161 Hepatitis B     102540243 (IFNB1)    05160 Hepatitis C     102540243 (IFNB1)    05171 Coronavirus disease - COVID-19     102540243 (IFNB1)    05164 Influenza A     102540243 (IFNB1)    05162 Measles     102540243 (IFNB1)    05168 Herpes simplex virus 1 infection     102540243 (IFNB1)    05163 Human cytomegalovirus infection     102540243 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     102540243 (IFNB1)    05169 Epstein-Barr virus infection     102540243 (IFNB1)    05165 Human papillomavirus infection     102540243 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     102540243 (IFNB1)    05152 Tuberculosis     102540243 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     102540243 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102540243 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102540243 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102540243 (IFNB1) Cytokines and neuropeptides [BR:vpc04052]  Cytokines   Interferons    102540243 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon PDDEXK_10 Benyvirus_14KDa Mer2 Motif Other DBs NCBI-GeneID:  102540243 NCBI-ProteinID:  XP_006208320 UniProt:  A0A6I9IE84 LinkDB All DBs Position 4 AA seq 186 aa AA seqDB search MIDRCILQIALLLCFSTAALSVNYNLLRYQQRSSNLACKNLLRQMPGIPQYCLEDRMDFD VPEEIKQPQQFQKEDAVLVIYEMLQQIFGIFRRDFSSTGWNKAIIQDLLVEIDVQIDHVE TILVEIMKEKNFTRGDMTILHLKMYYLKIVQYLKSKEYSGCAWTVVQAEILRNFSFLNSL TECLQD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgattgacaggtgcatcctccaaatcgctctcctattgtgtttctccaccgcagctctt tccgtgaactacaacttgcttcggtaccaacaaaggagcagcaacttggcatgtaagaat ctcctgcggcagatgcctggaatccctcagtattgccttgaggacaggatggactttgac gtccctgaggagattaagcaaccccagcagttccagaaggaagatgccgtattggtcatc tatgagatgctccagcagatctttggtattttcagaagagatttctcaagcactggctgg aataaggccatcattcaggacctccttgtagaaatcgatgtgcagatagaccatgtggag acaatcctggtggaaataatgaaggagaaaaacttcaccaggggagacatgaccattctt cacctgaagatgtattacttaaagatcgtgcagtacttgaagtccaaggagtacagcggc tgtgcctggacagtagtccaagcggaaatcctcaggaatttttccttccttaacagtctt acagaatgccttcaggactga

DBGET integrated database retrieval system