Vicugna pacos (alpaca): 102541329 Help Entry 102541329         CDS       T08098                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04060   Cytokine-cytokine receptor interaction vpc04151   PI3K-Akt signaling pathway vpc04630   JAK-STAT signaling pathway vpc04640   Hematopoietic cell lineage vpc04657   IL-17 signaling pathway vpc04658   Th1 and Th2 cell differentiation vpc04659   Th17 cell differentiation vpc04660   T cell receptor signaling pathway vpc04664   Fc epsilon RI signaling pathway vpc04672   Intestinal immune network for IgA production vpc05140   Leishmaniasis vpc05200   Pathways in cancer vpc05310   Asthma vpc05320   Autoimmune thyroid disease vpc05321   Inflammatory bowel disease vpc05330   Allograft rejection Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102541329 (IL4)    04151 PI3K-Akt signaling pathway     102541329 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102541329 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102541329 (IL4)    04660 T cell receptor signaling pathway     102541329 (IL4)    04658 Th1 and Th2 cell differentiation     102541329 (IL4)    04659 Th17 cell differentiation     102541329 (IL4)    04657 IL-17 signaling pathway     102541329 (IL4)    04664 Fc epsilon RI signaling pathway     102541329 (IL4)    04672 Intestinal immune network for IgA production     102541329 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102541329 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102541329 (IL4)   09163 Immune disease    05310 Asthma     102541329 (IL4)    05320 Autoimmune thyroid disease     102541329 (IL4)    05321 Inflammatory bowel disease     102541329 (IL4)    05330 Allograft rejection     102541329 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102541329 (IL4)    00536 Glycosaminoglycan binding proteins [BR:vpc00536]     102541329 (IL4) Cytokines and neuropeptides [BR:vpc04052]  Cytokines   Interleukins    102541329 (IL4) Glycosaminoglycan binding proteins [BR:vpc00536]  Heparan sulfate / Heparin   Cytokines    102541329 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 DUF4942 AAR2 SecIII_SopE_N Motif Other DBs NCBI-GeneID:  102541329 NCBI-ProteinID:  XP_006212888 UniProt:  A0A6I9IKM8 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MGLTSQLIPTLVCLLVCTSNFAHGHKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAP KNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLE RLKKIMKEKYSKC NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacttcccaactgatcccaaccctggtctgcttactggtttgtaccagcaac tttgcccacggacacaagtgtgatatcaccttgcaagagatcatcaaaacgctgaacacc ctcactgcgagaaagaattcgtgcatggagctgactgtagcagacgtctttgctgcccca aagaacacgactgagaaggaaaccttctgcaaggcggcaactgctcttcggcacatctac agacaccacaactgcttgagcaaacacctgagcggacttgacaggaacctcagcggcctg gcaaacacgacctgttctgtgaatgactccaagaagagcacattgagagacttcttggaa aggctaaagaagattatgaaggagaaatactcaaaatgttga

DBGET integrated database retrieval system