Vicugna pacos (alpaca): 102544627 Help Entry 102544627         CDS       T08098                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism vpc  Vicugna pacos (alpaca) Pathway vpc00510   N-Glycan biosynthesis vpc00513   Various types of N-glycan biosynthesis vpc04141   Protein processing in endoplasmic reticulum Module vpc_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:vpc00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     102544627 (TMEM258)    00513 Various types of N-glycan biosynthesis     102544627 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102544627 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  102544627 NCBI-ProteinID:  XP_006214935 UniProt:  A0A6I9IL31 LinkDB All DBs Position 25 AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagcttgaggccatgagcagatacaccagcccagtgaacccggctgtctttccccat ctgaccgtggtgctgttggccattggcatgtttttcactgcctggttcttcgtatatgag gtcacctccactaagtacactcgggacatctacaaagagctcctcatctcgttggtggct tcactcttcatgggctttggagtcctctttctgctgctctgggtcggcatctatgtatga

DBGET integrated database retrieval system