Vicugna pacos (alpaca): 116282869 Help Entry 116282869         CDS       T08098                                  Name (RefSeq) caspase-9-like   KO K04399   caspase 9 [EC:3.4.22.62] Organism vpc  Vicugna pacos (alpaca) Pathway vpc01524   Platinum drug resistance vpc04115   p53 signaling pathway vpc04151   PI3K-Akt signaling pathway vpc04210   Apoptosis vpc04215   Apoptosis - multiple species vpc04370   VEGF signaling pathway vpc04919   Thyroid hormone signaling pathway vpc05010   Alzheimer disease vpc05012   Parkinson disease vpc05014   Amyotrophic lateral sclerosis vpc05016   Huntington disease vpc05020   Prion disease vpc05022   Pathways of neurodegeneration - multiple diseases vpc05134   Legionellosis vpc05145   Toxoplasmosis vpc05152   Tuberculosis vpc05160   Hepatitis C vpc05161   Hepatitis B vpc05162   Measles vpc05163   Human cytomegalovirus infection vpc05164   Influenza A vpc05167   Kaposi sarcoma-associated herpesvirus infection vpc05168   Herpes simplex virus 1 infection vpc05169   Epstein-Barr virus infection vpc05170   Human immunodeficiency virus 1 infection vpc05200   Pathways in cancer vpc05210   Colorectal cancer vpc05212   Pancreatic cancer vpc05213   Endometrial cancer vpc05215   Prostate cancer vpc05222   Small cell lung cancer vpc05223   Non-small cell lung cancer vpc05416   Viral myocarditis vpc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04370 VEGF signaling pathway     116282869    04151 PI3K-Akt signaling pathway     116282869  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     116282869    04215 Apoptosis - multiple species     116282869    04115 p53 signaling pathway     116282869  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     116282869  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116282869   09162 Cancer: specific types    05210 Colorectal cancer     116282869    05212 Pancreatic cancer     116282869    05215 Prostate cancer     116282869    05213 Endometrial cancer     116282869    05222 Small cell lung cancer     116282869    05223 Non-small cell lung cancer     116282869   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116282869    05161 Hepatitis B     116282869    05160 Hepatitis C     116282869    05164 Influenza A     116282869    05162 Measles     116282869    05168 Herpes simplex virus 1 infection     116282869    05163 Human cytomegalovirus infection     116282869    05167 Kaposi sarcoma-associated herpesvirus infection     116282869    05169 Epstein-Barr virus infection     116282869   09171 Infectious disease: bacterial    05134 Legionellosis     116282869    05152 Tuberculosis     116282869   09174 Infectious disease: parasitic    05145 Toxoplasmosis     116282869   09164 Neurodegenerative disease    05010 Alzheimer disease     116282869    05012 Parkinson disease     116282869    05014 Amyotrophic lateral sclerosis     116282869    05016 Huntington disease     116282869    05020 Prion disease     116282869    05022 Pathways of neurodegeneration - multiple diseases     116282869   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116282869    05416 Viral myocarditis     116282869   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     116282869  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vpc01009]     116282869    01002 Peptidases and inhibitors [BR:vpc01002]     116282869 Enzymes [BR:vpc01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.62  caspase-9      116282869 Protein phosphatases and associated proteins [BR:vpc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      116282869 Peptidases and inhibitors [BR:vpc01002]  Cysteine peptidases   Family C14: caspase family    116282869 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CARD Peptidase_C14 CARD_2 Motif Other DBs NCBI-GeneID:  116282869 NCBI-ProteinID:  XP_031539453 UniProt:  A0A6J3B162 LinkDB All DBs Position 13 AA seq 283 aa AA seqDB search MNEADRQVLRRYRLRLVSELQVASLWDALLNRELFTPDMIEEIQRAGSGSRRDQARQLIT DLETRGSQALSLFISCLEDTGQNTLASLLRTSSQAARQHPEAIRPLDLKPVVLRPEGLKP ESLGVGKQDPLMPTPGKLVPVVLGPKELWPAKLRPEVLRPEAPRPVDIGSGGLSDVCAQD RAKGNANLAYVLSADPCGRCLIVNNVHFRRESGLRTRAGSSVDCERLQRRFRLLHFVVEV ECDLTAKVRSLPAERDGGGRDGVLQGTLKASDSPRRALPSVGP NT seq 852 nt NT seq  +upstreamnt  +downstreamnt atgaacgaggctgaccggcaggtcctgcgacggtaccggttgcggctggtgagcgagttg caggtggcctcgctctgggacgctttgctgaaccgcgagctcttcacccccgacatgatc gaggaaatccagcgggcaggctctgggtctcggcgtgatcaggccaggcagctgatcaca gatctagagactcgagggagtcaggccctttctttgttcatctcctgcttggaggacaca ggccagaacacgttggcttcattactgaggaccagtagtcaagcggcaaggcagcatccg gaggccatcagacccctggatcttaagcctgtggtgctgaggccagagggcctcaaacca gagtcgctgggagtgggtaagcaggatccattgatgccaaccccaggaaaactcgttcca gtggtgctggggccgaaggagctctggccggccaagctcaggcccgaggttctcagacca gaggcgcccaggccagtggacattggttctggaggactcagtgatgtctgtgctcaggac agagccaagggaaatgccaatttggcctatgtcctgagcgcggacccctgtggccgctgc ctcattgtcaacaacgtgcacttccgccgcgagtcggggctcaggacccgcgccggctcc agtgtggactgtgagaggctgcaacggcggttccgcttgctgcacttcgtggtggaggtg gagtgtgacctcacggccaaggtacggtccctgcccgcggagagagatgggggcgggcgg gacggtgtcctgcaagggaccctgaaagcaagcgactccccgagacgagcccttccgtct gtgggaccatga

DBGET integrated database retrieval system