Vigna radiata (mung bean): 106761091 Help Entry 106761091         CDS       T04126                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism vra  Vigna radiata (mung bean) Pathway vra03420   Nucleotide excision repair vra04120   Ubiquitin mediated proteolysis vra04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106761091    04120 Ubiquitin mediated proteolysis     106761091   09124 Replication and repair    03420 Nucleotide excision repair     106761091  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vra04121]     106761091    03400 DNA repair and recombination proteins [BR:vra03400]     106761091 Enzymes [BR:vra01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106761091 Ubiquitin system [BR:vra04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106761091   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      106761091    Cul2 complex      106761091    Cul3 complex      106761091    Cul4 complex      106761091    Cul7 complex      106761091    Cul8 complex      106761091    Cul9 complex      106761091 DNA repair and recombination proteins [BR:vra03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106761091     TCR (transcription coupled repair) factors      Cul4-CSA complex       106761091 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  106761091 NCBI-ProteinID:  XP_014500082 UniProt:  A0A1S3U243 LinkDB All DBs Position 5:34819706..34822474 Genome browser AA seq 118 aa AA seqDB search MATLDSDVTMVPAGEPSSSTGPSSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctactctggattctgacgtgactatggttccagctggcgaaccctccagcagcacc ggtccttcttcatccagcaagaagcccaagcgattcgagatcaagaagtggaatgcggtt gctctatgggcatgggatatcgttgtggacaattgtgctatctgcaggaaccatatcatg gatctctgtattgagtgccaggccaaccaggctagcgccactagcgaggaatgcactgta gcttggggagtttgtaaccatgcttttcacttccattgcataagcagatggcttaagacc cgacaagtatgtcccctagataatagcgagtgggagtttcagaaatatggtcactag

DBGET integrated database retrieval system