Vibrio tapetis subsp. tapetis: A0129 Help Entry A0129             CDS       T05424                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism vta  Vibrio tapetis subsp. tapetis Pathway vta00670   One carbon pool by folate vta00790   Folate biosynthesis vta01100   Metabolic pathways vta01240   Biosynthesis of cofactors vta04981   Folate transport and metabolism Module vta_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vta00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     A0129 (folA)    00670 One carbon pool by folate     A0129 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     A0129 (folA) Enzymes [BR:vta01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      A0129 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  SON48108 UniProt:  A0A2N8Z861 LinkDB All DBs Position A:132930..133439 Genome browser AA seq 169 aa AA seqDB search MWIGGVMKISMIAAMANDRVIGKDNDMPWHLPADFAWFKRSTMGKPVVMGRKTYQSIGRP LPGRKNIVVSRDPNLVIDGVETAISIERALELVDGVEEVMIIGGGSIYRECLPKAESLYL TYIKADIDGDTRFPDWGKGWLQTHNEHFEADEKNAYDMEFVVLERSAES NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgtggataggtggtgtgatgaaaattagtatgattgcagcgatggcaaatgatcgtgtg attggtaaagataacgatatgccttggcacttacctgccgattttgcttggttcaagcgc agtacgatgggaaaaccggtggtgatggggcgtaagacgtatcagtcgattggtcgtcct cttcctggtcgtaaaaatattgttgtcagccgagatcctaacttggtcattgacggagta gagactgccataagcattgaacgagcacttgaattagttgatggtgttgaagaagtgatg atcattggcggtggttcaatttatcgtgaatgcctaccaaaagcagagtcgctatatttg acgtatattaaagctgatattgacggtgatacacgcttccctgattggggaaagggttgg ttacaaactcataatgagcacttcgaagcagatgagaaaaatgcttacgatatggagttt gtggtgctagagcgaagtgctgaaagctaa

DBGET integrated database retrieval system