Vigna umbellata (ricebean): 124820988 Help Entry 124820988         CDS       T09662                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism vum  Vigna umbellata (ricebean) Pathway vum03420   Nucleotide excision repair vum04120   Ubiquitin mediated proteolysis vum04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124820988    04120 Ubiquitin mediated proteolysis     124820988   09124 Replication and repair    03420 Nucleotide excision repair     124820988  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vum04121]     124820988    03400 DNA repair and recombination proteins [BR:vum03400]     124820988 Enzymes [BR:vum01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      124820988 Ubiquitin system [BR:vum04121]  Ubiquitin ligases (E3)   UBL E3 ligases    124820988   Multi subunit type E3    SCF complex     Ring finger protein      124820988    Cul2 complex      124820988    Cul3 complex      124820988    Cul4 complex      124820988    Cul7 complex      124820988    Cul8 complex      124820988    Cul9 complex      124820988 DNA repair and recombination proteins [BR:vum03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       124820988     TCR (transcription coupled repair) factors      Cul4-CSA complex       124820988 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  124820988 NCBI-ProteinID:  XP_047148737 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MATIDSDVTMVPAGEPSSSTGPSSSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctactatagattctgacgtgaccatggttccggctggcgaaccctccagcagcaca ggtccttcttcatccagcaagaagccgaagcgattcgagatcaagaagtggaatgccgtt tctctatgggcatgggatatcgttgtggacaattgtgctatctgcaggaaccatatcatg gatctctgtattgagtgtcaggccaaccaggctagcgctactagtgaggaatgcactgta gcttggggagtttgtaaccatgcttttcacttccattgcataagcagatggctcaagacc cgtcaagtatgtccgctagataatagcgagtgggagtttcagaaatatggtcactag

DBGET integrated database retrieval system