Vigna unguiculata (cowpea): 114168583 Help Entry 114168583         CDS       T06017                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism vun  Vigna unguiculata (cowpea) Pathway vun03420   Nucleotide excision repair vun04120   Ubiquitin mediated proteolysis vun04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vun00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114168583    04120 Ubiquitin mediated proteolysis     114168583   09124 Replication and repair    03420 Nucleotide excision repair     114168583  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vun04121]     114168583    03400 DNA repair and recombination proteins [BR:vun03400]     114168583 Enzymes [BR:vun01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      114168583 Ubiquitin system [BR:vun04121]  Ubiquitin ligases (E3)   UBL E3 ligases    114168583   Multi subunit type E3    SCF complex     Ring finger protein      114168583    Cul2 complex      114168583    Cul3 complex      114168583    Cul4 complex      114168583    Cul7 complex      114168583    Cul8 complex      114168583    Cul9 complex      114168583 DNA repair and recombination proteins [BR:vun03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       114168583     TCR (transcription coupled repair) factors      Cul4-CSA complex       114168583 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  114168583 NCBI-ProteinID:  XP_027909272 LinkDB All DBs Position 11:complement(32029271..32031740) Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMIPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgactcttgattccgacgtgccaatgattccggctggcgagccatcgagcagcgcc gggccgtcttccaagaagcccaagcgtttcgagatcaagaaatggaacgccgtcgcactc tgggcttgggacatcgttgtcgataactgtgctatctgccggaaccacatcatggatcta tgcatcgagtgccaagccaaccaggccagcgcaactagcgaagaatgcactgtggcgtgg ggggtttgtaaccatgcttttcacttccactgcattagtcgatggctcaagacccgtcaa gtttgtcctctagataacagtgagtgggagtttcagaaatacggccactag

DBGET integrated database retrieval system