Vigna unguiculata (cowpea): 114177375 Help Entry 114177375         CDS       T06017                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism vun  Vigna unguiculata (cowpea) Pathway vun00510   N-Glycan biosynthesis vun00513   Various types of N-glycan biosynthesis vun04141   Protein processing in endoplasmic reticulum Module vun_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:vun00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     114177375    00513 Various types of N-glycan biosynthesis     114177375  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114177375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  114177375 NCBI-ProteinID:  XP_027918495 LinkDB All DBs Position 3:complement(59808929..59811032) Genome browser AA seq 76 aa AA seqDB search MAPKPITSPVPDSWYPTLSVFTLAIGLVLTASFFIYEATSSRKTRSLVQELATGAVASVF LGFGSLFLLIACGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccaaaaccgattacgagtcctgtgcccgattcgtggtaccccacactctccgtc tttaccctcgccatcggcctcgtcttaaccgcatctttcttcatttatgaagcaacctct tctaggaaaactcgttcacttgttcaggagcttgcaactggagcagttgcatcagtcttc ttgggttttgggtccttgttcctcttaattgcttgtggcgtttatgtctaa

DBGET integrated database retrieval system