Vulpes vulpes (red fox): 112921940 Help Entry 112921940         CDS       T05911                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism vvp  Vulpes vulpes (red fox) Pathway vvp04060   Cytokine-cytokine receptor interaction vvp04151   PI3K-Akt signaling pathway vvp04217   Necroptosis vvp04380   Osteoclast differentiation vvp04620   Toll-like receptor signaling pathway vvp04621   NOD-like receptor signaling pathway vvp04622   RIG-I-like receptor signaling pathway vvp04623   Cytosolic DNA-sensing pathway vvp04630   JAK-STAT signaling pathway vvp04650   Natural killer cell mediated cytotoxicity vvp04668   TNF signaling pathway vvp04936   Alcoholic liver disease vvp05135   Yersinia infection vvp05142   Chagas disease vvp05152   Tuberculosis vvp05160   Hepatitis C vvp05161   Hepatitis B vvp05162   Measles vvp05163   Human cytomegalovirus infection vvp05164   Influenza A vvp05165   Human papillomavirus infection vvp05167   Kaposi sarcoma-associated herpesvirus infection vvp05168   Herpes simplex virus 1 infection vvp05169   Epstein-Barr virus infection vvp05170   Human immunodeficiency virus 1 infection vvp05171   Coronavirus disease - COVID-19 vvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112921940 (IFNB1)    04668 TNF signaling pathway     112921940 (IFNB1)    04151 PI3K-Akt signaling pathway     112921940 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112921940 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112921940 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112921940 (IFNB1)    04621 NOD-like receptor signaling pathway     112921940 (IFNB1)    04622 RIG-I-like receptor signaling pathway     112921940 (IFNB1)    04623 Cytosolic DNA-sensing pathway     112921940 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     112921940 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     112921940 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112921940 (IFNB1)    05161 Hepatitis B     112921940 (IFNB1)    05160 Hepatitis C     112921940 (IFNB1)    05171 Coronavirus disease - COVID-19     112921940 (IFNB1)    05164 Influenza A     112921940 (IFNB1)    05162 Measles     112921940 (IFNB1)    05168 Herpes simplex virus 1 infection     112921940 (IFNB1)    05163 Human cytomegalovirus infection     112921940 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     112921940 (IFNB1)    05169 Epstein-Barr virus infection     112921940 (IFNB1)    05165 Human papillomavirus infection     112921940 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     112921940 (IFNB1)    05152 Tuberculosis     112921940 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     112921940 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112921940 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112921940 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112921940 (IFNB1) Cytokines and neuropeptides [BR:vvp04052]  Cytokines   Interferons    112921940 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112921940 NCBI-ProteinID:  XP_025857095 UniProt:  A0A3Q7TPK7 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTGRCIVQTTLLLYFSTMALAMSNDLLRFQLSSSSLECQELLLQLNGTPEYCLKDRVNFE IPEEIEKSRQFQKEDIILITHEMFQKIFDIFRRNISRTGWNETIVENLLVKLHWQKEHLE IILEDVKEKENFTWDNRTLLHLKKYYLRIVQYLKAKEYSICAWTIVRAEICRNFFFLNIL TDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccggtagatgcatcgtccaaacaactctcctgttgtatttctccaccatggctctt gccatgagcaacgacttgcttcgattccaactaagcagcagcagtttggagtgtcaggag ctcctattacagttgaatggaacccctgaatattgcctcaaggacagggtaaacttcgag atccctgaggagatcgagaaatcacgccagttccagaaggaggacatcatattgatcacc catgagatgttccagaagatctttgatattttcaggagaaatatctctagaacaggatgg aatgagactattgtcgagaaccttcttgtgaagctccactggcagaaggaacatctggag ataatcctggaggacgtcaaagagaaggaaaacttcacctgggacaacaggactcttctg cacctgaagaaatattacttaaggattgtgcagtacctgaaggccaaggaatacagcatc tgtgcctggacaatagtccgagcagaaatctgcaggaactttttcttccttaatatactt acagattatctccagaactga

DBGET integrated database retrieval system