Vulpes vulpes (red fox): 112922237 Help Entry 112922237         CDS       T05911                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism vvp  Vulpes vulpes (red fox) Pathway vvp03050   Proteasome vvp04060   Cytokine-cytokine receptor interaction vvp04066   HIF-1 signaling pathway vvp04217   Necroptosis vvp04350   TGF-beta signaling pathway vvp04380   Osteoclast differentiation vvp04612   Antigen processing and presentation vvp04630   JAK-STAT signaling pathway vvp04650   Natural killer cell mediated cytotoxicity vvp04657   IL-17 signaling pathway vvp04658   Th1 and Th2 cell differentiation vvp04659   Th17 cell differentiation vvp04660   T cell receptor signaling pathway vvp04940   Type I diabetes mellitus vvp05140   Leishmaniasis vvp05142   Chagas disease vvp05143   African trypanosomiasis vvp05144   Malaria vvp05145   Toxoplasmosis vvp05146   Amoebiasis vvp05152   Tuberculosis vvp05160   Hepatitis C vvp05164   Influenza A vvp05168   Herpes simplex virus 1 infection vvp05200   Pathways in cancer vvp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer vvp05321   Inflammatory bowel disease vvp05322   Systemic lupus erythematosus vvp05323   Rheumatoid arthritis vvp05330   Allograft rejection vvp05332   Graft-versus-host disease vvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vvp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     112922237 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     112922237 (IFNG)    04630 JAK-STAT signaling pathway     112922237 (IFNG)    04066 HIF-1 signaling pathway     112922237 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112922237 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112922237 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     112922237 (IFNG)    04612 Antigen processing and presentation     112922237 (IFNG)    04660 T cell receptor signaling pathway     112922237 (IFNG)    04658 Th1 and Th2 cell differentiation     112922237 (IFNG)    04659 Th17 cell differentiation     112922237 (IFNG)    04657 IL-17 signaling pathway     112922237 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     112922237 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112922237 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112922237 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     112922237 (IFNG)    05164 Influenza A     112922237 (IFNG)    05168 Herpes simplex virus 1 infection     112922237 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     112922237 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     112922237 (IFNG)    05144 Malaria     112922237 (IFNG)    05145 Toxoplasmosis     112922237 (IFNG)    05140 Leishmaniasis     112922237 (IFNG)    05142 Chagas disease     112922237 (IFNG)    05143 African trypanosomiasis     112922237 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     112922237 (IFNG)    05323 Rheumatoid arthritis     112922237 (IFNG)    05321 Inflammatory bowel disease     112922237 (IFNG)    05330 Allograft rejection     112922237 (IFNG)    05332 Graft-versus-host disease     112922237 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112922237 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112922237 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:vvp03051]     112922237 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112922237 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:vvp00536]     112922237 (IFNG) Proteasome [BR:vvp03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     112922237 (IFNG) Cytokines and neuropeptides [BR:vvp04052]  Cytokines   Interferons    112922237 (IFNG) Glycosaminoglycan binding proteins [BR:vvp00536]  Heparan sulfate / Heparin   Cytokines    112922237 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma TssR_C Motif Other DBs NCBI-GeneID:  112922237 NCBI-ProteinID:  XP_025857464 UniProt:  Q25BC0 A4GTA8 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MNYTSYILAFQLCVILCSSGCNCQAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWR EESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQ IPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagctatatcttagcttttcagctttgcgtgattttgtgttcttctggc tgtaactgtcaggccatgttttttaaagaaatagaaaacctaaaggaatattttaacgca agtaatccagatgtatcggacggtgggtctcttttcgtagatattttgaagaaatggaga gaggagagtgacaaaacaatcattcagagccaaattgtctctttctacttgaaactgttt gacaactttaaagataaccagatcattcaaaggagcatggataccatcaaggaagacatg cttggcaagttcttaaatagcagcaccagtaagagggaggacttccttaagctgattcaa attcctgtgaacgatctgcaggtccagcgcaaggcgataaatgaactcatcaaagtgatg aatgatctctcaccaagatccaacctaaggaagcggaaaaggagtcagaatctgtttcga ggccgcagagcatcgaaataa

DBGET integrated database retrieval system