Vulpes vulpes (red fox): 112933647 Help Entry 112933647         CDS       T05911                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism vvp  Vulpes vulpes (red fox) Pathway vvp01521   EGFR tyrosine kinase inhibitor resistance vvp04010   MAPK signaling pathway vvp04014   Ras signaling pathway vvp04015   Rap1 signaling pathway vvp04020   Calcium signaling pathway vvp04151   PI3K-Akt signaling pathway vvp04550   Signaling pathways regulating pluripotency of stem cells vvp04810   Regulation of actin cytoskeleton vvp05167   Kaposi sarcoma-associated herpesvirus infection vvp05200   Pathways in cancer vvp05205   Proteoglycans in cancer vvp05207   Chemical carcinogenesis - receptor activation vvp05218   Melanoma vvp05224   Breast cancer vvp05226   Gastric cancer Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112933647 (FGF2)    04014 Ras signaling pathway     112933647 (FGF2)    04015 Rap1 signaling pathway     112933647 (FGF2)    04020 Calcium signaling pathway     112933647 (FGF2)    04151 PI3K-Akt signaling pathway     112933647 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     112933647 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112933647 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112933647 (FGF2)    05205 Proteoglycans in cancer     112933647 (FGF2)    05207 Chemical carcinogenesis - receptor activation     112933647 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     112933647 (FGF2)    05218 Melanoma     112933647 (FGF2)    05224 Breast cancer     112933647 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     112933647 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112933647 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112933647 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:vvp00536]     112933647 (FGF2) Cytokines and neuropeptides [BR:vvp04052]  Cytokines   Growth factors (RTK binding)    112933647 (FGF2) Glycosaminoglycan binding proteins [BR:vvp00536]  Heparan sulfate / Heparin   Growth factors/receptors    112933647 (FGF2) SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  112933647 NCBI-ProteinID:  XP_025872608 UniProt:  A0A3Q7TS21 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHV KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcagccgggagcatcaccacgctgcccgccctgccggaggacggcggcagcggcgcc ttcccgcccggccacttcaaggaccccaagaggctgtactgcaagaacgggggcttcttc ctgcgcatccaccccgacggccgggtggacggggtccgggagaagagcgacccccacgtc aaattgcaacttcaagcagaagagagaggcgttgtgtccatcaaaggagtatgtgcaaat cgctatcttgctatgaaggaagatggaagattactggcttctaaatgtgttaccgacgag tgcttcttttttgaacgattggaatctaataactacaatacttaccggtcaaggaaatac tccagttggtatgtggcactgaaacgaactgggcagtataaacttggaccaaaaacagga cctgggcagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system