Vibrio vulnificus YJ016: VV0568 Help Entry VV0568            CDS       T00150                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism vvy  Vibrio vulnificus YJ016 Pathway vvy00790   Folate biosynthesis vvy01100   Metabolic pathways vvy01240   Biosynthesis of cofactors Module vvy_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vvy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     VV0568 Enzymes [BR:vvy01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      VV0568  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      VV0568  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      VV0568 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Bro-N Motif Other DBs NCBI-ProteinID:  BAC93332 UniProt:  Q7MNZ6 LinkDB All DBs Position I:550049..550408 Genome browser AA seq 119 aa AA seqDB search MALDKVFIEQLEVITTIGVYDWEQQIKQKLVLDIEMAHDNRPAGKSDDVADALDYAQVSE AVLNHIENGRFLLVERVAEEVAELIMTQFSVPWIRIRLAKPGAVPQARAVGVVIERGQA NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcgctggataaagtgtttattgaacagttggaagtgattaccaccattggtgtctac gactgggaacagcaaattaagcaaaaattggtgttggatatcgaaatggcgcacgacaat cgtcctgcaggcaaaagtgatgatgtggccgatgcgttggattatgcacaagtgagcgag gcggtattgaatcacattgaaaacggtcgtttcttactggtggaacgcgtcgcggaagaa gtggctgagctcatcatgactcaattctcagtgccttggattcgcattcgcttagctaag ccgggagctgttccacaagctcgcgctgtgggtgtggtgattgagcgaggccaagcatga

DBGET integrated database retrieval system