KEGG   Weissella ceti WS105: WS105_0562
Entry
WS105_0562        CDS       T03295                                 
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
wci  Weissella ceti WS105
Pathway
wci00061  Fatty acid biosynthesis
wci00780  Biotin metabolism
wci01100  Metabolic pathways
wci01110  Biosynthesis of secondary metabolites
wci01212  Fatty acid metabolism
wci01240  Biosynthesis of cofactors
Module
wci_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:wci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WS105_0562
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    WS105_0562
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    WS105_0562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:wci01004]
    WS105_0562
Enzymes [BR:wci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     WS105_0562
Lipid biosynthesis proteins [BR:wci01004]
 Fatty acid synthase
  Component type
   WS105_0562
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR Epimerase NmrA 3Beta_HSD NAD_binding_10 DUF1776
Other DBs
NCBI-ProteinID: AIM64152
UniProt: A0A075TVC2
LinkDB
Position
complement(643232..643954)
AA seq 240 aa
MQIADKTVLVTGSTRGIGLAIAQRLSQAGARIILHGRQMPSATLLSQFPENTLVMTGDIS
DATQMQNAIDDLYANDVTIDILVNNAGIVADGLMVRLPTDAIDRVIDTNLKGTFYVTQPI
FKKMMRQRTGVIINMASVVGQMGNVGQANYAAAKAGMIGFTKSLAREGAMRGIRVNAIAP
GMIVSDMTDALPDAQKETLLAEIPLKRFGTTTEIAQATQFLIENDYMTGQTITIDGGLHI
NT seq 723 nt   +upstreamnt  +downstreamnt
atgcagatagctgataagaccgtcttggtgacgggatcaacacgtggtattggtttagcc
attgcccaacgtcttagccaagccggggcgcgaattattttgcatggccgtcagatgccg
agcgcaactttactcagtcaatttccagaaaacacgttggttatgacgggtgatatttct
gacgcaacgcaaatgcaaaatgcgattgatgatttatatgccaacgatgtcaccattgat
atcttggtgaataatgcggggattgttgcggacggattaatggtccgtttaccaacagat
gccatcgatcgtgtcattgatacgaatctaaagggaacattctatgttacccaaccgatt
tttaagaaaatgatgcgccaacgtacaggagtcattattaatatggcctcggtagttgga
caaatgggtaatgtgggacaagcaaattatgcggcagcgaaagcggggatgattggtttc
actaagtcgcttgcccgtgaaggtgcgatgcgtggtattcgtgtgaatgccattgcgccg
gggatgattgtctctgatatgacggatgctttgccggacgcccaaaaagaaacgttattg
gctgaaattccattgaagcgttttgggacaacaacggaaattgcacaagcaacccaattt
ttaattgaaaatgattatatgaccggacaaacaatcacgattgatggtggattacacatc
taa

DBGET integrated database retrieval system