Wallemia ichthyophaga: J056_004250 Help Entry J056_004250       CDS       T03457                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism wic  Wallemia ichthyophaga Pathway wic03420   Nucleotide excision repair wic04111   Cell cycle - yeast wic04120   Ubiquitin mediated proteolysis wic04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:wic00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     J056_004250    04120 Ubiquitin mediated proteolysis     J056_004250   09124 Replication and repair    03420 Nucleotide excision repair     J056_004250  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     J056_004250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:wic04121]     J056_004250    03400 DNA repair and recombination proteins [BR:wic03400]     J056_004250 Enzymes [BR:wic01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      J056_004250 Ubiquitin system [BR:wic04121]  Ubiquitin ligases (E3)   UBL E3 ligases    J056_004250   Multi subunit type E3    SCF complex     Ring finger protein      J056_004250    Cul2 complex      J056_004250    Cul3 complex      J056_004250    Cul4 complex      J056_004250    Cul7 complex      J056_004250    Cul8 complex      J056_004250    Cul9 complex      J056_004250 DNA repair and recombination proteins [BR:wic03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       J056_004250     TCR (transcription coupled repair) factors      Cul4-CSA complex       J056_004250 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  20377202 NCBI-ProteinID:  XP_009267726 UniProt:  R9AGV6 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MTEDTHQTHQSMDIDKAPPKKPRFQVKKWNAVALWNWDIAVDNCAICRNQIMDLCIECQA NQASATTNECVVAWGICNHAFHFHCISRWLKTRHVCPLDNREWALQKYGK NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgaccgaggatactcaccaaacacatcaatcgatggatatcgacaaggccccaccaaag aagccacgttttcaagtaaaaaagtggaatgccgttgccctgtggaactgggatatcgca gtagacaactgtgctatctgtagaaaccagataatggatctttgtattgaatgccaagcc aatcaagcttctgcaacgacaaatgagtgtgtcgttgcctggggaatctgcaaccacgct ttccactttcattgcatatctcgttggcttaaaacgaggcacgtctgtccactcgataat cgtgagtgggcgttgcagaagtatggtaagtaa

DBGET integrated database retrieval system