Weissella sagaensis: AB9G37_01190 Help Entry AB9G37_01190      CDS       T11351                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism wsa  Weissella sagaensis Pathway wsa01100   Metabolic pathways wsa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:wsa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB9G37_01190 (acpP)    00074 Mycolic acid biosynthesis     AB9G37_01190 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB9G37_01190 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  XEC91733 LinkDB All DBs Position 226705..226947 Genome browser AA seq 80 aa AA seqDB search MERQEILDKVITLVADHFELDPAKVTGETNFTKDIDADSIDFVELVLEMEDEFGAEISDE DAEQLITVNNTVDYIASHTK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaacgacaagaaattttggataaagtaatcacattagttgctgatcattttgaattg gatccagctaaagtaacaggtgaaactaactttacaaaggacattgatgctgattcaatt gattttgttgaactagtacttgaaatggaagacgaatttggtgctgaaatttcagatgaa gacgctgaacaattaattacagttaataatactgttgattatattgcttcacatactaag taa

DBGET integrated database retrieval system