Xanthomonas sp. GW: HEP73_00519 Help Entry HEP73_00519       CDS       T08755                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism xag  Xanthomonas sp. GW Pathway xag00790   Folate biosynthesis xag01100   Metabolic pathways xag01240   Biosynthesis of cofactors Module xag_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:xag00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HEP73_00519 Enzymes [BR:xag01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HEP73_00519  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HEP73_00519  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HEP73_00519 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QNH19622 UniProt:  A0A7G7SSA2 LinkDB All DBs Position 596882..597241 Genome browser AA seq 119 aa AA seqDB search MDKVFIEGLEIDALIGIYDWERRIRQTLRFDLEMGFDNRVPAASDDIADTLNYKAVSKRL VELVEQSDYGLVETLAERCAAAVLAEFEVRWLRLKLSKPGAVRGAQAVGVIIERSRDAG NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggataaagttttcatcgaaggtctagaaatcgatgcgctgatcggcatctacgattgg gagcggcggatccggcagaccttgcgcttcgatctggagatgggcttcgacaaccgggtg ccggcggccagcgacgacatcgccgatacgctcaactacaaggcggtcagcaagcgcctg gtggagctggtcgagcagtccgactacggcctggtggagacgctggccgagcgctgcgca gcggcggtgttggccgagttcgaggtgcgctggctgcggctgaagttgagcaagccgggg gcggtgcgcggcgcgcaggcggtgggcgtgatcatcgaacgcagccgcgacgccggctga

DBGET integrated database retrieval system