Xenorhabdus sp. TH1: WDV74_02245 Help Entry WDV74_02245       CDS       T11385                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism xet  Xenorhabdus sp. TH1 Pathway xet00670   One carbon pool by folate xet00790   Folate biosynthesis xet01100   Metabolic pathways xet01240   Biosynthesis of cofactors xet04981   Folate transport and metabolism Module xet_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:xet00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     WDV74_02245 (folA)    00670 One carbon pool by folate     WDV74_02245 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     WDV74_02245 (folA) Enzymes [BR:xet01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      WDV74_02245 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 DUF7466 Motif Other DBs NCBI-ProteinID:  WXG10591 LinkDB All DBs Position 517192..517677 Genome browser AA seq 161 aa AA seqDB search MIISLIAAMAMDRVIGMENAMPWTLPGDLAWFKRNTLGKPVVMGRVTYESIGRPLPGRLN IVISSQPANDDRVTWVNSIEAALAAAGDVKEVMVMGGGKIYEQFIPLAHRMYLTHIDAEV IGDTHFPDYEPDEWNSTFTEYHDADENNSHGYCFEILERRD NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcttgattgctgcgatggctatggatcgagttatcggtatggaaaatgcc atgccatggactttgccgggtgatttagcctggtttaaacgcaatacacttggaaagccg gttgtaatggggcgagtgacttatgagtcgattggccgtcctttgccagggcgcctgaat atcgtgatcagcagtcaacctgcaaatgatgatcgggttacttgggttaactctattgaa gctgctttagctgccgctggcgatgttaaagaagtgatggtgatgggaggaggaaaaatt tatgaacaatttattcctctggctcatcgtatgtatctgactcacattgatgcagaagtg attggtgacacgcatttccctgattatgagcctgatgaatggaattcaacgtttaccgaa tatcacgatgcagatgaaaacaattcccatggctattgttttgaaattctggaacgccga gattga

DBGET integrated database retrieval system