Xiphias gladius (swordfish): 120790934 Help Entry 120790934         CDS       T07311                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism xgl  Xiphias gladius (swordfish) Pathway xgl03030   DNA replication xgl03410   Base excision repair xgl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:xgl00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     120790934 (pole4)    03410 Base excision repair     120790934 (pole4)    03420 Nucleotide excision repair     120790934 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:xgl03032]     120790934 (pole4)    03400 DNA repair and recombination proteins [BR:xgl03400]     120790934 (pole4) Enzymes [BR:xgl01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      120790934 (pole4) DNA replication proteins [BR:xgl03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     120790934 (pole4) DNA repair and recombination proteins [BR:xgl03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       120790934 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  120790934 NCBI-ProteinID:  XP_039984873 LinkDB All DBs Position LG6:17585336..17587336 Genome browser AA seq 129 aa AA seqDB search MAAIVASPITPTELDPDRCGSEEESRGAEAEEESSQQQTGPIAAVSHSRLSKLPLARIKA LMKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE FAFLEGTLD NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggctgcaatagtggcatcgcctatcacccccacggagctcgaccctgaccggtgcgga agcgaggaggagagccgcggggccgaggcggaggaggagagcagccagcagcagacaggc cccattgccgccgtgagccacagccgactatccaaactcccgctggcccgcatcaaggcg ctcatgaagaccgacccagacgtgtccctcgccagccaggagtctgtgttcatcatcgct aaagccacggagttgtttgttgagatgattgccaaagacgccctggtgtatgcccagcaa ggcaagaggaaaactttgcaaagaaaagacttggacaacgcgatagaggccatagatgaa tttgcatttcttgaaggcactctagattaa

DBGET integrated database retrieval system