Xenopus laevis (African clawed frog): 101027283
Help
Entry
101027283 CDS
T01010
Symbol
ifng.L
Name
(RefSeq) interferon gamma
KO
K04687
interferon gamma
Organism
xla
Xenopus laevis (African clawed frog)
Pathway
xla03050
Proteasome
xla04060
Cytokine-cytokine receptor interaction
xla04217
Necroptosis
xla04350
TGF-beta signaling pathway
xla05168
Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:
xla00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
101027283 (ifng.L)
09130 Environmental Information Processing
09132 Signal transduction
04350 TGF-beta signaling pathway
101027283 (ifng.L)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
101027283 (ifng.L)
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
101027283 (ifng.L)
09160 Human Diseases
09172 Infectious disease: viral
05168 Herpes simplex virus 1 infection
101027283 (ifng.L)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
xla03051
]
101027283 (ifng.L)
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
xla04052
]
101027283 (ifng.L)
00536 Glycosaminoglycan binding proteins [BR:
xla00536
]
101027283 (ifng.L)
Proteasome [BR:
xla03051
]
Eukaryotic proteasome
Assembling factors
Other assembling factors
101027283 (ifng.L)
Cytokines and neuropeptides [BR:
xla04052
]
Cytokines
Interferons
101027283 (ifng.L)
Glycosaminoglycan binding proteins [BR:
xla00536
]
Heparan sulfate / Heparin
Cytokines
101027283 (ifng.L)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
IFN-gamma
Lipoprotein_20
MCM_N
Motif
Other DBs
NCBI-GeneID:
101027283
NCBI-ProteinID:
XP_018107195
Xenbase:
XB-GENE-17334390
UniProt:
A0A1L8GYI9
A0A974DBJ8
LinkDB
All DBs
Position
3L:complement(65470680..65479530)
Genome browser
AA seq
182 aa
AA seq
DB search
MRQSYRLLCFCVILYWVGHVSGYSVNLKDASTATEELRKYFNSIDHEDKNNGLVFKKFFD
SWKEEGEEKIVLSQIVPVYLKILDSISKMKNEKLQMSIKNLKMMLNTLYDDLLKKMDQKL
RGLNDLKTIQVGDVTTQHSAIKELFMVLRELSIMEKTKNHAIKKQKQDFQRQNRRSRYHS
RY
NT seq
549 nt
NT seq
+upstream
nt +downstream
nt
atgagacaatcatataggctgctctgtttctgtgtcattctttattgggttggacacgtc
tctggatattctgtcaatctaaaggatgcaagcactgccactgaagaactgaggaaatat
tttaactccattgaccatgaggataaaaataacggacttgtttttaagaagttttttgac
tcttggaaagaggaaggagaggaaaaaattgtactgagccagattgttccagtttatttg
aagattcttgactccatttctaaaatgaaaaatgaaaagctacaaatgagcattaaaaac
ctcaaaatgatgcttaatacattatatgatgacttgctaaagaaaatggaccagaaactc
agaggcctaaatgatctaaagacaatacaggtgggagatgttacaacccaacattctgct
attaaagaacttttcatggttttgagagaactgtcgataatggaaaaaacgaaaaaccat
gccattaaaaaacaaaaacaagatttccagcgacaaaatagaaggagtagatatcattct
agatactaa
DBGET
integrated database retrieval system