KEGG   Xenopus laevis (African clawed frog): 101027283
Entry
101027283         CDS       T01010                                 
Symbol
ifng.L
Name
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03050  Proteasome
xla04060  Cytokine-cytokine receptor interaction
xla04217  Necroptosis
xla04350  TGF-beta signaling pathway
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101027283 (ifng.L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101027283 (ifng.L)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101027283 (ifng.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101027283 (ifng.L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101027283 (ifng.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:xla03051]
    101027283 (ifng.L)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:xla04052]
    101027283 (ifng.L)
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    101027283 (ifng.L)
Proteasome [BR:xla03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101027283 (ifng.L)
Cytokines and neuropeptides [BR:xla04052]
 Cytokines
  Interferons
   101027283 (ifng.L)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate / Heparin
  Cytokines
   101027283 (ifng.L)
SSDB
Motif
Pfam: IFN-gamma Lipoprotein_20 MCM_N
Other DBs
NCBI-GeneID: 101027283
NCBI-ProteinID: XP_018107195
Xenbase: XB-GENE-17334390
UniProt: A0A1L8GYI9 A0A974DBJ8
LinkDB
Position
3L:complement(65470680..65479530)
AA seq 182 aa
MRQSYRLLCFCVILYWVGHVSGYSVNLKDASTATEELRKYFNSIDHEDKNNGLVFKKFFD
SWKEEGEEKIVLSQIVPVYLKILDSISKMKNEKLQMSIKNLKMMLNTLYDDLLKKMDQKL
RGLNDLKTIQVGDVTTQHSAIKELFMVLRELSIMEKTKNHAIKKQKQDFQRQNRRSRYHS
RY
NT seq 549 nt   +upstreamnt  +downstreamnt
atgagacaatcatataggctgctctgtttctgtgtcattctttattgggttggacacgtc
tctggatattctgtcaatctaaaggatgcaagcactgccactgaagaactgaggaaatat
tttaactccattgaccatgaggataaaaataacggacttgtttttaagaagttttttgac
tcttggaaagaggaaggagaggaaaaaattgtactgagccagattgttccagtttatttg
aagattcttgactccatttctaaaatgaaaaatgaaaagctacaaatgagcattaaaaac
ctcaaaatgatgcttaatacattatatgatgacttgctaaagaaaatggaccagaaactc
agaggcctaaatgatctaaagacaatacaggtgggagatgttacaacccaacattctgct
attaaagaacttttcatggttttgagagaactgtcgataatggaaaaaacgaaaaaccat
gccattaaaaaacaaaaacaagatttccagcgacaaaatagaaggagtagatatcattct
agatactaa

DBGET integrated database retrieval system