Xanthomonas oryzae pv. oryzae PXO86: AZ54_13260
Help
Entry
AZ54_13260 CDS
T03765
Name
(GenBank) NAD-dependent DNA ligase LigA
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
xoy
Xanthomonas oryzae pv. oryzae PXO86
Pathway
xoy03030
DNA replication
xoy03410
Base excision repair
xoy03420
Nucleotide excision repair
xoy03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
xoy00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
AZ54_13260
03410 Base excision repair
AZ54_13260
03420 Nucleotide excision repair
AZ54_13260
03430 Mismatch repair
AZ54_13260
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
xoy03032
]
AZ54_13260
03400 DNA repair and recombination proteins [BR:
xoy03400
]
AZ54_13260
Enzymes [BR:
xoy01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
AZ54_13260
DNA replication proteins [BR:
xoy03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
AZ54_13260
DNA repair and recombination proteins [BR:
xoy03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
AZ54_13260
NER (nucleotide excision repair)
GGR (global genome repair) factors
AZ54_13260
MMR (mismatch excision repair)
DNA ligase
AZ54_13260
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
AZ54_13260
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
DNA_ligase_ZBD
Nlig-Ia
PTCB-BRCT
DUF7501
DUF4796_N
Motif
Other DBs
NCBI-ProteinID:
AJQ83453
LinkDB
All DBs
Position
complement(2726448..2728973)
Genome browser
AA seq
841 aa
AA seq
DB search
MEQGVIERARELRRRIENADHRYYDLADPEITDAQYDQLFRELQELEQKYPELVTADSPS
MRVGGAVRKSFVKVRHSIPMLSLANAFDEVEVKNFVDRIFRRMGSSNPLEFSVEPKFDGL
AISLRYELGKFVQGVTRGDGDVGEDVSENIRTIRSVPLKLKGNNVPAILEVRGEVYMPRD
GFSEFNKRAMARGEKLLANPRNGAAGSLRQLDSRISAQRPLSFFAYGVGLIQVEQDLFEE
IPQSIASTHSAMLAQLRAWGFPVSSLVEVVQGSDGLLAYYQRIGEARDGLPFDIDGVVYK
LDDLAGQREMGFVSRAPRWALAHKFPAQEQSTTVEAIEIQIGRTGAATPVARLKPVHVAG
VIVTNATLHNADQIARLDVRVGDTVIVRRAGDVIPEVAAVVADQRPPATQSWQMPTQCPV
CGSEIVREEGQAVWRCSGELTCPAQRKEAFRHFVSRRAMDVDGLGEKFIEVLVDSGVVQG
VADLYLLTVDQLLQLRMISTAESPHAFLREAREHLASGAYAQLEATLVGIGVDLAGEREV
PQTWQADLLRAGLPTFDWNRKKIATKWAENLIEAIETSRDTTLERFLFALGIEHVGESTA
KALSAWFGDLDLIRHLPWPLFKRVPDIGGEVARSLGHFFDQPGNQKAIDHLLARKVRIGD
THPPSPKLRGELRLANLLEDLEIPKVTPIRAAQIATAFGSIDALRNGGPEPLVEAGVPQS
VAESLATWLLVPANDTLAVKAQKKLSALLAMMPEAGEEKTGPLDGQTVVITGTLAALTRD
AAKQRLEALGAKVAGSVSKKTAFLVAGEEAGSKLDKAQSLGVEIWDEARLLAFLGEHGQQ
R
NT seq
2526 nt
NT seq
+upstream
nt +downstream
nt
atggagcaaggtgtgattgagcgggcacgagagcttcggcggcgtatcgaaaatgctgac
caccggtattacgatcttgcagatcctgaaattacagatgctcagtacgaccagctcttt
agagagttacaggaactggagcagaagtatccagaactagtcacggctgactcaccgtcc
atgagggtgggtggagcagtgcggaaatcatttgtaaaagttagacactcaatccccatg
ctttctttggcgaatgcatttgatgaagttgaggtcaaaaacttcgttgatcgaattttt
cgtcgaatgggcagctcgaacccgctcgaattttctgtagagccaaaatttgatggtcta
gcaattagcttgcgttacgaactaggcaagttcgttcaaggtgtgacccgtggtgacggc
gatgttggcgaggatgttagtgagaacattcggacaataaggtcagttccattgaaatta
aagggcaacaacgttccggctatcttagaggttcggggtgaagtctatatgccacgtgat
gggttttctgaattcaataagcgtgctatggctcggggcgaaaaacttctcgccaatccg
aggaatggggccgcgggctctttgcgtcagctagatagtcgtatctcggctcagcgtccg
ctttctttttttgcatatggggtagggctcattcaagtagagcaggacctctttgaggag
attccgcaaagtattgcgtcaactcattcagcaatgctggcgcagctgcgcgcgtgggga
tttccagtgagttcgctagtcgaagtggtgcagggcagcgacggtctgctggcgtattac
cagcgcatcggtgaggcgcgcgacggcttgcccttcgatatcgatggcgtggtctacaag
ctcgacgatctggccgggcaacgcgagatgggcttcgtctcgcgtgcgccgcgttgggcg
cttgcgcacaagttcccggcgcaggaacagtccaccaccgtcgaagccatcgagatccag
atcggacgtaccggtgcggccacgccggtggcgcgtttgaagccggtgcatgtggccggg
gtgatcgtcaccaatgccacgctgcacaacgccgaccagatcgcgcggctggatgtgcgc
gtgggcgatacggtgatcgtgcgccgcgccggcgatgtgattcctgaagtggccgccgtg
gtagccgaccaacgccctcccgcaacgcagtcgtggcagatgcccacgcaatgcccggtc
tgcggttcggagatcgtgcgcgaagaaggtcaggcggtgtggcgctgctccggcgagttg
acctgcccggcgcagcgcaaggaagccttccggcatttcgtctcgcggcgcgcgatggat
gtggatggtctgggcgaaaaattcatcgaggtgttggtcgacagcggcgtggtgcaaggt
gtggccgatctgtatctgctcacggtggatcagctgctgcaactgcgcatgatcagcacg
gccgaaagtccgcatgcgttcttgcgcgaggcgcgcgagcatctggccagcggcgcgtat
gcacagctggaagccaccttggtcggtatcggcgtggacctggccggcgagcgcgaggtg
ccgcaaacctggcaggccgatctactgcgcgcaggcctgccgacgttcgactggaatcgc
aagaagatcgccaccaagtgggcagagaatctgatcgaggcgattgaaacatcgcgcgac
accacgctggagcgttttctgtttgcgctgggcatcgaacacgtaggcgaaagcacggcg
aaggcgttgtcggcgtggtttggcgatctggacttgattcgtcatctgccctggccgctg
ttcaagcgcgtgccggatatcggtggagaagtggcgcgttcgctggggcatttcttcgat
cagcccgggaatcagaaggccatcgatcatctgctggcgcgcaaggtgcgcatcggcgac
acccatccgccttcgccgaagctgcgtggcgagctgcgcttggccaatttgctggaggac
ctggagattcccaaggtgacgccgattcgcgccgcccagatcgcgactgcgtttggttcc
atcgatgccctgcgcaatggcggtcccgagcctctcgtcgaagcgggtgtaccgcagtca
gtggccgagtcgctcgcgacttggctgttggtgccggccaacgacacgctcgcggttaaa
gcccagaaaaagctttccgcgctgctggctatgatgccggaggctggcgaagaaaagact
ggcccgctcgatggacagaccgtggtcatcaccgggaccttggctgcgctgacgcgcgat
gcggccaagcagcggctggaagcattgggcgccaaggtcgccggtagcgtctccaagaag
acggcgtttctggtggccggcgaagaagccggttccaagctcgacaaggcgcaatcgctg
ggcgtggagatctgggacgaagcgcgtctgctggccttcctgggcgaacacggccaacag
cgatga
DBGET
integrated database retrieval system