Yersinia canariae: F0T03_03730 Help Entry F0T03_03730       CDS       T06446                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism yca  Yersinia canariae Pathway yca00670   One carbon pool by folate yca00790   Folate biosynthesis yca01100   Metabolic pathways yca01240   Biosynthesis of cofactors yca04981   Folate transport and metabolism Module yca_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:yca00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     F0T03_03730 (folA)    00670 One carbon pool by folate     F0T03_03730 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     F0T03_03730 (folA) Enzymes [BR:yca01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      F0T03_03730 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QHB31377 UniProt:  A0A857EV98 LinkDB All DBs Position 781090..781572 Genome browser AA seq 160 aa AA seqDB search MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN IVISSQPGTDDRVTWATSIDDALALAGDVEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV GGDTHFPDYEPDEWESIFSEFHDADEANSHSYCFEILERR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgatcgctgcattggcagcggatcgcgtgattggtatggaaaacgcc atgccatggcacttaccggctgatttggcgtggttcaaacgtaacacgttaaataaaccg gtaataatgggtcgtaagactttcgaatctattggtcgccctctgccagggcggttgaat attgtgattagtagccaaccgggcactgatgaccgagtgacatgggcaacttctattgat gatgcacttgctttagcgggtgatgtggaggaagtgatggttatgggcggtgggcgtgtc tacaagcagttcttagaccgggctaaccgcatgtatctcactcacattgatgctgaagtt gggggcgatactcacttcccagattatgagccagatgaatgggaaagtatttttagtgag ttccatgatgcagacgaggctaattcgcacagttattgtttcgagattttggaacgacgc taa

DBGET integrated database retrieval system