Yersinia enterocolitica WA: CH47_2855 Help Entry CH47_2855         CDS       T03643                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism yew  Yersinia enterocolitica WA Pathway yew00670   One carbon pool by folate yew00790   Folate biosynthesis yew01100   Metabolic pathways yew01240   Biosynthesis of cofactors yew04981   Folate transport and metabolism Module yew_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:yew00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CH47_2855 (folA)    00670 One carbon pool by folate     CH47_2855 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CH47_2855 (folA) Enzymes [BR:yew01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CH47_2855 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AJI84851 LinkDB All DBs Position complement(3084227..3084709) Genome browser AA seq 160 aa AA seqDB search MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN IVISSQPGTDDRVTWATSIDDALALAGDAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV GGDTHFPDYEPDEWESIFSEFHDADEANSHSYCFEILERR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgattgctgcattggcagcggatcgcgttattggtatggaaaacgcc atgccatggcacttaccagccgatttagcctggttcaaacgtaacacgctaaataaaccg gtcattatgggccgcaagacattcgaatctattggtcgccctctgccggggcggttgaat attgttatcagtagccaaccgggaacggatgatcgggtaacgtgggcaacctctattgac gacgcactcgctttggcaggcgatgcggaagaagtgatggtgatgggtggcggccgtgtc tataagcaattcttagaccgcgctaaccgtatgtatcttactcacattgatgctgaagtt gggggcgatacccattttccagattatgagccagatgagtgggaaagtatctttagtgaa ttccatgatgcagacgaggctaattcacacagctattgtttcgagatccttgaacgtcgc taa

DBGET integrated database retrieval system