Yersinia pestis 91001 (biovar Microtus): YP_3693 Help Entry YP_3693           CDS       T00165                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ypm  Yersinia pestis 91001 (biovar Microtus) Pathway ypm00670   One carbon pool by folate ypm00790   Folate biosynthesis ypm01100   Metabolic pathways ypm01240   Biosynthesis of cofactors ypm04981   Folate transport and metabolism Module ypm_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ypm00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     YP_3693 (folA)    00670 One carbon pool by folate     YP_3693 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     YP_3693 (folA) Enzymes [BR:ypm01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      YP_3693 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AAS63841 UniProt:  A0AAX2I517 LinkDB All DBs Position complement(4205458..4205940) Genome browser AA seq 160 aa AA seqDB search MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN IVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV GGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgatcgctgcattggcagcagatcgcgttattggcatggaaaacgct atgccatggcatttaccggctgatttagcgtggttcaaacgtaacacgttaaataaaccg gtaattatgggtcgtaagaccttcgaatctatcggtcgcccccttccgggaagactgaat attgtcatcagtagccagcctggtactgatgaacgtgtgacgtgggcggcctcgattgaa gaagcattggcgtttgctggcaatgcggaagaagtgatggtcatgggcggtggccgtgtc tataagcaattcttagaccgcgcaaatcgcatgtatctcacgcatattgatgcggaggtc ggtggcgatactcacttccctgattatgagccagatgaatgggaaagcgtattcagtgag tttcatgatgccgatgaagctaactcacacagttattgcttcgaaattctagagcgccgc taa

DBGET integrated database retrieval system