Yersinia pseudotuberculosis MD67: BZ21_4011 Help Entry BZ21_4011         CDS       T03677                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ypu  Yersinia pseudotuberculosis MD67 Pathway ypu00670   One carbon pool by folate ypu00790   Folate biosynthesis ypu01100   Metabolic pathways ypu01240   Biosynthesis of cofactors ypu04981   Folate transport and metabolism Module ypu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ypu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BZ21_4011 (folA)    00670 One carbon pool by folate     BZ21_4011 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     BZ21_4011 (folA) Enzymes [BR:ypu01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      BZ21_4011 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AJJ04775 UniProt:  A0A0T9JQ07 LinkDB All DBs Position 4519680..4520162 Genome browser AA seq 160 aa AA seqDB search MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN IVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV GGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgatcgctgcattggcagcagatcgcgttattggcatggaaaacgct atgccatggcatttaccggctgatttagcgtggttcaaacgtaacacgttaaataaaccg gtaattatgggtcgtaagaccttcgaatctatcggtcgcccccttccgggaagactgaat attgtcatcagtagccagcctggcactgatgaacgtgtgacgtgggcggcctcgattgaa gaagcattggcgtttgctggcaatgcggaagaagtgatggtcatgggcggtggccgcgtc tataagcaattcttagaccgcgcaaatcgcatgtatctcacgcatattgatgcggaggtc ggtggcgatactcacttccctgattatgagccagatgaatgggaaagcgtattcagtgag tttcatgatgccgatgaagctaactcacacagttattgcttcgaaattctagagcgccgc taa

DBGET integrated database retrieval system