Yersinia pestis D182038: YPD8_0425 Help Entry YPD8_0425         CDS       T01833                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ypx  Yersinia pestis D182038 Pathway ypx00670   One carbon pool by folate ypx00790   Folate biosynthesis ypx01100   Metabolic pathways ypx01240   Biosynthesis of cofactors ypx04981   Folate transport and metabolism Module ypx_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ypx00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     YPD8_0425 (folA)    00670 One carbon pool by folate     YPD8_0425 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     YPD8_0425 (folA) Enzymes [BR:ypx01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      YPD8_0425 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  ACY61115 LinkDB All DBs Position 516933..517415 Genome browser AA seq 160 aa AA seqDB search MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN IVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV GGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgatcgctgcattggcagcagatcgcgttattggcatggaaaacgct atgccatggcatttaccggctgatttagcgtggttcaaacgtaacacgttaaataaaccg gtaattatgggtcgtaagaccttcgaatctatcggtcgcccccttccgggaagactgaat attgtcatcagtagccagcctggtactgatgaacgtgtgacgtgggcggcctcgattgaa gaagcattggcgtttgctggcaatgcggaagaagtgatggtcatgggcggtggccgtgtc tataagcaattcttagaccgcgcaaatcgcatgtatctcacgcatattgatgcggaggtc ggtggcgatactcacttccctgattatgagccagatgaatgggaaagcgtattcagtgag tttcatgatgccgatgaagctaactcacacagttattgcttcgaaattctagagcgccgc taa

DBGET integrated database retrieval system