Yersinia ruckeri YRB: BD65_2518 Help Entry BD65_2518         CDS       T03611                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism yru  Yersinia ruckeri YRB Pathway yru00670   One carbon pool by folate yru00790   Folate biosynthesis yru01100   Metabolic pathways yru01240   Biosynthesis of cofactors yru04981   Folate transport and metabolism Module yru_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:yru00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BD65_2518 (folA)    00670 One carbon pool by folate     BD65_2518 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     BD65_2518 (folA) Enzymes [BR:yru01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      BD65_2518 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AJI95801 LinkDB All DBs Position 2765550..2766032 Genome browser AA seq 160 aa AA seqDB search MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN IVISSQSGADSRVSWATSIDEALALAGEVEEVMVMGGGHVYSQFLDRAHRMYLTHIDAEV GGDTHFPDYEPDEWETSFSEFHDADEANSHSYCFEVLERR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgattgctgcactggcggcggatcgcgttatcggtatggaaaatgcc atgccgtggcacttaccggctgacttagcgtggtttaaacgtaacacgctgaataaaccg gtgattatggggcgtaaaacgtttgaatcaattggacgtccgcttccaggacgtttgaac attgtgatcagtagccagtcgggtgccgatagccgagtgagttgggcgacgtcaatcgat gaagctttggctttggcgggtgaagtggaagaagtgatggtgatggggggaggacacgtc tatagccaatttctcgatcgtgcgcatcgtatgtatctcacccatattgatgctgaagtg ggtggcgatactcacttccctgattatgagcctgatgagtgggaaacttctttcagcgag tttcatgacgctgatgaagccaactctcatagttattgctttgaggtgctagagcgtcgt tag

DBGET integrated database retrieval system