Zea mays (maize): 103634739 Help Entry 103634739         CDS       T01088                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism zma  Zea mays (maize) Pathway zma03420   Nucleotide excision repair zma04120   Ubiquitin mediated proteolysis zma04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:zma00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103634739    04120 Ubiquitin mediated proteolysis     103634739   09124 Replication and repair    03420 Nucleotide excision repair     103634739  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:zma04121]     103634739    03400 DNA repair and recombination proteins [BR:zma03400]     103634739 Enzymes [BR:zma01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103634739 Ubiquitin system [BR:zma04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103634739   Multi subunit type E3    SCF complex     Ring finger protein      103634739    Cul2 complex      103634739    Cul3 complex      103634739    Cul4 complex      103634739    Cul7 complex      103634739    Cul8 complex      103634739    Cul9 complex      103634739 DNA repair and recombination proteins [BR:zma03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103634739     TCR (transcription coupled repair) factors      Cul4-CSA complex       103634739 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  103634739 NCBI-ProteinID:  NP_001288413 UniProt:  C0P5V1 LinkDB All DBs Position 8:complement(8514638..8527278) Genome browser AA seq 123 aa AA seqDB search MSAMETDINAPPPAPAGEGSSVVGPSSSSSRKPNKRFEIKKWNAVALWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgtccgccatggagaccgacatcaacgcgccgccgcccgccccagccggcgagggatcc tccgtggtcggtccgtcctcctcatcctcccgcaagcccaacaagcgcttcgagatcaag aagtggaacgccgtcgcgctctgggcatgggatatcgtcgtcgacaactgcgccatctgc cgcaaccacatcatggatctatgcatcgagtgccaggcgaaccaagctagcgcgaccagc gaggagtgcactgtcgcttggggtgtctgtaatcatgcttttcacttccactgcatcagc aggtggcttaagactcgccaagtgtgcccattagataacagtgagtgggagttccagaaa tatggccactag

DBGET integrated database retrieval system