Zea mays (maize): 103649912 Help Entry 103649912         CDS       T01088                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism zma  Zea mays (maize) Pathway zma03420   Nucleotide excision repair zma04120   Ubiquitin mediated proteolysis zma04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:zma00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103649912    04120 Ubiquitin mediated proteolysis     103649912   09124 Replication and repair    03420 Nucleotide excision repair     103649912  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:zma04121]     103649912    03400 DNA repair and recombination proteins [BR:zma03400]     103649912 Enzymes [BR:zma01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103649912 Ubiquitin system [BR:zma04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103649912   Multi subunit type E3    SCF complex     Ring finger protein      103649912    Cul2 complex      103649912    Cul3 complex      103649912    Cul4 complex      103649912    Cul7 complex      103649912    Cul8 complex      103649912    Cul9 complex      103649912 DNA repair and recombination proteins [BR:zma03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103649912     TCR (transcription coupled repair) factors      Cul4-CSA complex       103649912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  103649912 NCBI-ProteinID:  XP_008673817 UniProt:  A0A8J8XP77 A0A096QRS2 LinkDB All DBs Position 3:complement(30356588..30360749) Genome browser AA seq 122 aa AA seqDB search MSAMETDINAPPPPAPAGEGSSAAGPSSSRKPNKRFEIKKWNAVALWAWDIVVDNCAICR NHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKY GH NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtccgccatggagaccgacatcaacgcgccgccgccgcccgccccagctggcgaggga tcctctgcggccggtccgtcctcctcccgcaagcccaacaagcgcttcgagatcaagaag tggaacgccgtcgcgctctgggcatgggatatcgtcgtcgacaactgcgctatctgccgc aaccacatcatggatctatgcatcgagtgccaggcgaaccaagccagcgcgaccagcgag gagtgcactgttgcttggggagtctgtaatcatgcttttcacttccactgcatcagcagg tggcttaagactcgtcaagtgtgcccattagataacagtgagtgggagttccagaaatat ggccactag

DBGET integrated database retrieval system