Zymomonas mobilis subsp. mobilis ZM4: ZMO0321 Help Entry ZMO0321           CDS       T00221                                  Name (GenBank) dihydrofolate reductase region   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism zmo  Zymomonas mobilis subsp. mobilis ZM4 Pathway zmo00670   One carbon pool by folate zmo00790   Folate biosynthesis zmo01100   Metabolic pathways zmo01240   Biosynthesis of cofactors zmo04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:zmo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ZMO0321    00670 One carbon pool by folate     ZMO0321  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     ZMO0321 Enzymes [BR:zmo01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      ZMO0321 SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Methyltransf_2 Motif Other DBs NCBI-ProteinID:  AAV88945 UniProt:  Q5NQQ9 LinkDB All DBs Position 317965..318390 Genome browser AA seq 141 aa AA seqDB search MPWHISADLKHFKALTLGHPMIMGRRTFESLPGLLPKRPHIVLTHNHHWQAEGAEAVCDL EEAIKAARKYSSQIAVIGGANIFQQFWDKADRIELTEIYRDYSGDTFVDLPDMNHFSLVG QEDFKAEGECPAFSFKSFLRK NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgccttggcatatttctgctgatttgaaacattttaaggccttaacgcttggtcatccg atgattatggggcggcggacttttgagagtttgcccggcttgctgccgaaaaggccacat attgttttgacccataatcatcattggcaggcggagggtgccgaagctgtttgtgatttg gaagaggccataaaagcggctcggaaatatagtagccagatcgcggtgattggtggagcc aatatttttcaacaattttgggataaagcggatcggatcgaactgaccgaaatttatcgc gattattccggtgatacctttgtcgatttgccggatatgaatcatttttctttggtaggg caagaggattttaaagcagaaggtgaatgccctgcttttagtttcaaatcatttctaagg aaataa

DBGET integrated database retrieval system