Zingiber officinale (ginger): 121981914 Help Entry 121981914         CDS       T08725                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism zof  Zingiber officinale (ginger) Pathway zof03420   Nucleotide excision repair zof04120   Ubiquitin mediated proteolysis zof04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:zof00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121981914    04120 Ubiquitin mediated proteolysis     121981914   09124 Replication and repair    03420 Nucleotide excision repair     121981914  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:zof04121]     121981914    03400 DNA repair and recombination proteins [BR:zof03400]     121981914 Enzymes [BR:zof01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121981914 Ubiquitin system [BR:zof04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121981914   Multi subunit type E3    SCF complex     Ring finger protein      121981914    Cul2 complex      121981914    Cul3 complex      121981914    Cul4 complex      121981914    Cul7 complex      121981914    Cul8 complex      121981914    Cul9 complex      121981914 DNA repair and recombination proteins [BR:zof03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121981914     TCR (transcription coupled repair) factors      Cul4-CSA complex       121981914 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  121981914 NCBI-ProteinID:  XP_042390630 LinkDB All DBs Position 5A:133379785..133383961 Genome browser AA seq 125 aa AA seqDB search MASLDTDVDMVQGGEGSIVADVVSPSSIASSSSKKPKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcttctcttgataccgacgtcgacatggttcaaggcggtgaaggttcaatcgtcgcc gacgttgtgtcgccgtcttccatcgcttcctcctctagtaaaaagccaaagaggttcgag attaagaaatggaacgctgtcgccctctgggcctgggatatcgtggtggacaactgcgct atttgtaggaatcacatcatggatctctgcatcgagtgtcaggctaaccaggcaagtgcg actagtgaagagtgcacagtggcttggggggtttgcaatcatgccttccatttccattgc atcagccgttggctcaaaactcgtcaagtctgccccttggacaacagtgagtgggagttc cagaaatatggccactag

DBGET integrated database retrieval system