Zingiber officinale (ginger): 121985754 Help Entry 121985754         CDS       T08725                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism zof  Zingiber officinale (ginger) Pathway zof03420   Nucleotide excision repair zof04120   Ubiquitin mediated proteolysis zof04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:zof00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121985754    04120 Ubiquitin mediated proteolysis     121985754   09124 Replication and repair    03420 Nucleotide excision repair     121985754  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:zof04121]     121985754    03400 DNA repair and recombination proteins [BR:zof03400]     121985754 Enzymes [BR:zof01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121985754 Ubiquitin system [BR:zof04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121985754   Multi subunit type E3    SCF complex     Ring finger protein      121985754    Cul2 complex      121985754    Cul3 complex      121985754    Cul4 complex      121985754    Cul7 complex      121985754    Cul8 complex      121985754    Cul9 complex      121985754 DNA repair and recombination proteins [BR:zof03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121985754     TCR (transcription coupled repair) factors      Cul4-CSA complex       121985754 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  121985754 NCBI-ProteinID:  XP_042395311 LinkDB All DBs Position 5B:123291220..123295541 Genome browser AA seq 125 aa AA seqDB search MASLDTDVDMVQGGEGSIVADVVSPSSIASSSSKKPKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcttctcttgataccgacgtcgacatggttcaaggcggtgaaggttcaatcgtcgcc gacgttgtgtcgccgtcttccatcgcttcatcctctagtaaaaagccaaagaggttcgag attaagaaatggaacgctgtcgccctctgggcctgggatatcgtggtggacaactgcgct atttgtaggaatcacatcatggatctctgcatcgagtgtcaggctaaccaggcaagtgcg actagtgaagagtgcacagtggcttggggggtttgcaatcatgccttccatttccattgc atcagccgttggctcaaaactcgtcaagtctgccccttggacaacagtgagtgggagttc cagaaatatggccactag

DBGET integrated database retrieval system