Zingiber officinale (ginger): 122017693 Help Entry 122017693         CDS       T08725                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism zof  Zingiber officinale (ginger) Pathway zof03420   Nucleotide excision repair zof04120   Ubiquitin mediated proteolysis zof04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:zof00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122017693    04120 Ubiquitin mediated proteolysis     122017693   09124 Replication and repair    03420 Nucleotide excision repair     122017693  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:zof04121]     122017693    03400 DNA repair and recombination proteins [BR:zof03400]     122017693 Enzymes [BR:zof01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      122017693 Ubiquitin system [BR:zof04121]  Ubiquitin ligases (E3)   UBL E3 ligases    122017693   Multi subunit type E3    SCF complex     Ring finger protein      122017693    Cul2 complex      122017693    Cul3 complex      122017693    Cul4 complex      122017693    Cul7 complex      122017693    Cul8 complex      122017693    Cul9 complex      122017693 DNA repair and recombination proteins [BR:zof03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       122017693     TCR (transcription coupled repair) factors      Cul4-CSA complex       122017693 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  122017693 NCBI-ProteinID:  XP_042431298 LinkDB All DBs Position 8B:complement(106084793..106087133) Genome browser AA seq 125 aa AA seqDB search MASMDTDVDMVPVGEGSSVGVAGSSSAAASSSSKKPKRFEIKKWNAVSLWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcttctatggacacggacgtcgacatggttccagtcggtgaaggttcaagcgtcggc gtcgcgggatcgtcctccgccgccgcttcctcctcttcgaaaaagccgaagaggttcgag atcaagaagtggaacgctgtctccctctgggcctgggatattgtggtggacaactgcgct atttgtaggaatcacatcatggatctctgcatcgagtgccaggctaaccaggcgagtgcg actagtgaggagtgcacagtggcttggggcgtctgcaatcatgccttccatttccactgt atcagtcgttggcttaaaactcgccaagtctgtcccttggacaacagcgaatgggagttc cagaaatatggtcactag

DBGET integrated database retrieval system