Zingiber officinale (ginger): 122052315 Help Entry 122052315         CDS       T08725                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism zof  Zingiber officinale (ginger) Pathway zof03420   Nucleotide excision repair zof04120   Ubiquitin mediated proteolysis zof04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:zof00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122052315    04120 Ubiquitin mediated proteolysis     122052315   09124 Replication and repair    03420 Nucleotide excision repair     122052315  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:zof04121]     122052315    03400 DNA repair and recombination proteins [BR:zof03400]     122052315 Enzymes [BR:zof01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      122052315 Ubiquitin system [BR:zof04121]  Ubiquitin ligases (E3)   UBL E3 ligases    122052315   Multi subunit type E3    SCF complex     Ring finger protein      122052315    Cul2 complex      122052315    Cul3 complex      122052315    Cul4 complex      122052315    Cul7 complex      122052315    Cul8 complex      122052315    Cul9 complex      122052315 DNA repair and recombination proteins [BR:zof03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       122052315     TCR (transcription coupled repair) factors      Cul4-CSA complex       122052315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  122052315 NCBI-ProteinID:  XP_042469720 LinkDB All DBs Position 3A:complement(115961080..115974049) Genome browser AA seq 125 aa AA seqDB search MASLDTDVDMVPAGEGSSSGATGSSSLTPSTSSKKPKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcttccctcgacaccgacgtcgacatggttccggcaggcgaggggtcgagcagcggg gctaccgggtcgtcctccttgaccccttccacttcctcgaagaagccgaaaaggttcgag attaaaaagtggaacgctgtcgccctctgggcctgggatatcgtggtggacaactgtgct atctgtaggaaccacatcatggatctttgcatcgagtgtcaggctaatcaggcgagtgcg accagtgaggagtgcacagtggcttggggggtctgcaatcatgctttccatttccattgc atcagccgatggctcaagactcgtcaagtttgccccctcgacaatagcgagtgggagttc cagaaatatgggcactag

DBGET integrated database retrieval system