Zootoca vivipara (common lizard): 118076349 Help Entry 118076349         CDS       T07275                                  Symbol RAN Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism zvi  Zootoca vivipara (common lizard) Pathway zvi03008   Ribosome biogenesis in eukaryotes zvi03013   Nucleocytoplasmic transport zvi03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:zvi00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     118076349 (RAN)    03008 Ribosome biogenesis in eukaryotes     118076349 (RAN)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     118076349 (RAN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:zvi03019]     118076349 (RAN)    03009 Ribosome biogenesis [BR:zvi03009]     118076349 (RAN)    03016 Transfer RNA biogenesis [BR:zvi03016]     118076349 (RAN)    03036 Chromosome and associated proteins [BR:zvi03036]     118076349 (RAN)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zvi04147]     118076349 (RAN)    04031 GTP-binding proteins [BR:zvi04031]     118076349 (RAN) Messenger RNA biogenesis [BR:zvi03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      118076349 (RAN) Ribosome biogenesis [BR:zvi03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     118076349 (RAN)   Pre-60S particles     118076349 (RAN) Transfer RNA biogenesis [BR:zvi03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     118076349 (RAN) Chromosome and associated proteins [BR:zvi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      118076349 (RAN)    Spindle formation proteins     118076349 (RAN) Exosome [BR:zvi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118076349 (RAN) GTP-binding proteins [BR:zvi04031]  Small (monomeric) G-proteins   Ran Family    Ran     118076349 (RAN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RNA_helicase G-alpha Pox_A32 AAA_24 ArgoMid Septin AAA_7 SRPRB TsaE AAA_16 DUF5906 AAA_22 Motif Other DBs NCBI-GeneID:  118076349 NCBI-ProteinID:  XP_034954924 LinkDB All DBs Position LG17:6847961..6856543 Genome browser AA seq 217 aa AA seqDB search MAAPQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPI KFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVL CGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM PALAPPEVVMDPALAAQYEQDLQIAQTTALPDEDDDL NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggccgccccgcaaggagaacctcaagtgcagtttaagcttgttttggttggtgatggt ggtactggtaaaacaacatttgtaaaacgtcacttgactggtgaatttgagaagaagtat gtagctactctgggtgttgaagttcatcctctggtgttccacactaacagaggtcctatt aaatttaatgtatgggacacagctggacaggagaaatttggaggtctgcgagatggctac tacatccaagctcaatgtgccatcataatgtttgatgtaacatcaagagttacatacaag aacgtacccaactggcatagagatctggtacgggtgtgtgagaatatccccatagttttg tgtggcaacaaagtggatatcaaggacaggaaagtcaaagcaaagtcgattgttttccac aggaagaagaacctgcagtactacgatatttcagccaagagtaactataattttgagaaa ccctttctttggctggcaagaaagctaatcggagatcccaacttggaattcgttgccatg cctgctcttgcaccaccagaggtcgttatggatccagcattggcagcacagtatgagcaa gatttacagattgctcagaccactgcactgccagatgaagatgatgacctgtga

DBGET integrated database retrieval system