Zootoca vivipara (common lizard): 118077849 Help Entry 118077849         CDS       T07275                                  Name (RefSeq) actin, cytoplasmic 3-like   KO K05692   actin beta/gamma 1 Organism zvi  Zootoca vivipara (common lizard) Pathway zvi03082   ATP-dependent chromatin remodeling zvi04145   Phagosome zvi04210   Apoptosis zvi04510   Focal adhesion zvi04520   Adherens junction zvi04530   Tight junction zvi04810   Regulation of actin cytoskeleton zvi04814   Motor proteins zvi04820   Cytoskeleton in muscle cells zvi05100   Bacterial invasion of epithelial cells zvi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:zvi00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     118077849  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     118077849   09143 Cell growth and death    04210 Apoptosis     118077849   09144 Cellular community - eukaryotes    04510 Focal adhesion     118077849    04520 Adherens junction     118077849    04530 Tight junction     118077849   09142 Cell motility    04814 Motor proteins     118077849    04820 Cytoskeleton in muscle cells     118077849    04810 Regulation of actin cytoskeleton     118077849  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118077849    05100 Bacterial invasion of epithelial cells     118077849  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:zvi03021]     118077849    03019 Messenger RNA biogenesis [BR:zvi03019]     118077849    03036 Chromosome and associated proteins [BR:zvi03036]     118077849    03029 Mitochondrial biogenesis [BR:zvi03029]     118077849   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:zvi04812]     118077849    04147 Exosome [BR:zvi04147]     118077849 Transcription machinery [BR:zvi03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      118077849 Messenger RNA biogenesis [BR:zvi03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      118077849 Chromosome and associated proteins [BR:zvi03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      118077849     NuA4 complex      118077849   Chromatin remodeling factors    BAF complex     118077849    PBAF complex     118077849    GBAF(ncBAF) complex     118077849    SWR1 complex     118077849 Mitochondrial biogenesis [BR:zvi03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     118077849 Cytoskeleton proteins [BR:zvi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      118077849 Exosome [BR:zvi04147]  Exosomal proteins   Proteins found in most exosomes    118077849 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  118077849 NCBI-ProteinID:  XP_034957467 LinkDB All DBs Position Unknown AA seq 257 aa AA seqDB search MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIKRL DLAGRDLTDYLMKILTERGYNFVTTAEREIVRDIKEKLCYVALDFDQEMATASSSSSLEK SYELPDGQVITIGNERFRCPEALFQPSFLGLELAGIHEETYNSIMKCDVDIRKDLYANTV LSGGSTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS KQEYDESGPSIVHRKCF NT seq 774 nt NT seq  +upstreamnt  +downstreamnt atgacgcagatcatgtttgagactttcaacacgccagccatgtacgtggccatccaggcc gtgctgtcgctctatgcgtctggccgcaccaccgggattgtcatggactctggggacggc gtgacccacacggtgcccatctatgaggggtatgccctgccccacgccatcaagcgcctg gacctggctggccgtgacctgactgactacctcatgaagatcctgactgagaggggctac aacttcgtcaccacggccgagagggagatcgtgcgggacatcaaggagaagctctgctac gtggccctggactttgatcaggagatggccacggccagctcatcttcctccctggagaag agctatgagctgccagacgggcaggtgatcaccattggcaacgagcgcttccggtgcccc gaggctctcttccagccctccttcctgggcttggagttggctggcatccacgaggaaacc tacaactccatcatgaaatgcgatgtggacatccgcaaggacctgtatgccaacacggtg ctctctggcggcagcaccatgtaccctggcattgctgaccggatgcagaaggagatcacc tccctggctcccagcacgatgaagatcaagatcattgccccgccagagcgcaaatattca gtgtggatcgggggctccatcctggcctctctctccaccttccagcagatgtggatcagc aagcaggagtacgatgagtctggcccatccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system