Zootoca vivipara (common lizard): 118096423 Help Entry 118096423         CDS       T07275                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism zvi  Zootoca vivipara (common lizard) Pathway zvi04060   Cytokine-cytokine receptor interaction zvi04672   Intestinal immune network for IgA production zvi04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:zvi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118096423 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118096423 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     118096423 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:zvi04052]     118096423 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:zvi00536]     118096423 (CXCL12) Cytokines and neuropeptides [BR:zvi04052]  Cytokines   Chemokines    118096423 (CXCL12) Glycosaminoglycan binding proteins [BR:zvi00536]  Heparan sulfate / Heparin   Chemokines    118096423 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118096423 NCBI-ProteinID:  XP_034994130 LinkDB All DBs Position LG14:complement(10033786..10055655) Genome browser AA seq 94 aa AA seqDB search MDSKAAFLALLLLLGTLRAADGKPISLTYRCPCRYFESNVAKSHVKHLKILTVPGCSLQI IARLKNSSKQICVDPKLRWMQEYLEKYLHKRFKM NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggacagcaaagccgccttcctcgccttgctgctgctcctcgggaccctccgcgccgcc gacgggaaacccatcagcctgacttaccgctgcccgtgcagatattttgagagcaatgta gctaaatcccatgtgaagcatctcaagatcttgactgtccctggctgttccctgcagatc attgcaagactgaaaaacagcagcaaacagatctgcgtcgatcccaagttaaggtggatg caagagtatctggagaaatacctgcacaagagattcaagatgtaa

DBGET integrated database retrieval system