KEGG   Astyanax mexicanus (Mexican tetra): 103025923
Entry
103025923         CDS       T05042                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04012  ErbB signaling pathway
amex04068  FoxO signaling pathway
amex04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103025923 (cdkn1b)
   04068 FoxO signaling pathway
    103025923 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103025923 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103025923
NCBI-ProteinID: XP_007231643
Ensembl: ENSAMXG00000015174
LinkDB
Position
8
AA seq 171 aa
MSNVRLSNGSPTLERMDNRPPDQPKPSACRSLFGPVDHEELKRELKGHLMAMEKASTESW
NFDFSNFTPRRGRYLWSPVDSTDLPGFYSSTGNKSVDVNGNHERLAERSETQTERRDPQQ
NVKNKRKRRSSLDSSCQTKRSRTCVDEVSCRPGLTQALDHTPVKSSPQRQT
NT seq 516 nt   +upstreamnt  +downstreamnt
atgtctaatgtgcgtctctcgaacggaagcccgaccctggagaggatggacaaccggccg
cccgaccagccgaagccgagcgcctgcaggagcctgttcgggccggtggatcacgaagag
ttaaagagggagttaaagggacacttgatggcgatggagaaggcgtcgaccgagtcgtgg
aacttcgacttctccaacttcacgcctcggcgcggccgctacctgtggtcccccgtggac
agcacggacttaccgggcttctacagctcgacagggaataagagcgtggatgtaaacggg
aatcacgagcggctcgcggagcggagcgagacccagaccgaaaggagagacccgcaacag
aacgtcaagaacaagagaaaaagacggtcgtccctcgattcctcgtgtcagactaaacgc
tcgcgcacctgtgtggatgaagtctcgtgccggccgggtttgacccaggcgctcgatcac
acacccgtgaagtcgagcccccagcggcagacgtga

DBGET integrated database retrieval system