KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386367
Entry
100386367         CDS       T03264                                 

Gene name
ADAR
Definition
(RefSeq) adenosine deaminase, RNA specific
  KO
K12968  double-stranded RNA-specific adenosine deaminase [EC:3.5.4.37]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05162  Measles
cjc05164  Influenza A
cjc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100386367 (ADAR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100386367 (ADAR)
   05164 Influenza A
    100386367 (ADAR)
   05162 Measles
    100386367 (ADAR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100386367 (ADAR)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.37  double-stranded RNA adenine deaminase
     100386367 (ADAR)
Spliceosome [BR:cjc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    100386367 (ADAR)
SSDB
Motif
Pfam: A_deamin z-alpha dsrm DND1_DSRM TrmB
Other DBs
NCBI-GeneID: 100386367
NCBI-ProteinID: XP_017821801
Ensembl: ENSCJAG00000009410
LinkDB
Position
18
AA seq 1373 aa
MQGWGSTCNRCETKRWRKVCSNPSSWPNFPEGKAFRGNESEIESEPSWAPRADRGVSRAD
ASGPLPLRRSGSVGVSRGWCGARVVVLAGRAGQCLAGTMNPQQGHSLSGYYPYPFQGYEH
RKVRHQQPGPGSSPSSFRHKQIEFLKGQLPEAPVIGKQTPSLSPSLPGLWPRFPALPVYS
TGFRKEEIWGVPRSVHFGRQGLQRAFQHPSPRGRILPQRGVDCLSSDFQELNINQDQEQR
ILKLLKELGEGKATTVHDLSGKLRAPKKEINRVLYSLAKKGKLQKEAGIPPLWKISASAQ
ARNQHSRAVRPDGHSKGAPNSDPSLEPEDRNSTSVSEDFTEPFITVSAQARNQLSRAVRP
DGHSQGAPNSDPSLEPEDRNSTSVSEDFTEPFITVSAQARNQHSRAVRPDGHSQGAPNSE
PSLEPEDGNSTSALEDPLELFDMAEIKEKICDYLFNVSDSSALNLAKNIGLSKARDINAV
LIDLERQGDVSRQGTTPPMWHLTDKKRERMQIKRNVNSVLETAPSAIPEIQRHAEFPTCN
LPTSNASNNMVTTEKVENGQEPVVKLENRQETRPEPVRLKPPVHNNGPSRAGYVDFENGQ
WATDDIPDDLNSIRAAPGEFRAIMEMPSFYSHGLPRCSPYKKLTECQLKNPISGLLEYAQ
FASQTCEFNLIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAMKAMTILLEEA
KAKDSGKSEESSHYSTEKESEKTAESQPSAPSATPFFSGKSPVTTLLECMHKLGNSCEFR
LLSKEGPAHEPKFEYCVQVGAQTFPSVSAPSKKVAKQMAAEEAMKALHGEATNSMLSDDQ
PEGTISESLDNLESMMPNKVRRIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPP
HEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFAEVTPVTGA
TLRRTMLLLSRSPEAQPKTLPVTGSTFHDQIAMLSHRCFNTLTNSLQPSLLGRKILAAIV
MKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNPQ
TAKDSIFEPAKGGGKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMENTDSRHYPVFE
NPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALL
THFLQPIYLKSVTLGYLFSQGHLTRAICCRMARDGSAFEDGLRHPFIVNHPKVGRVSVYD
SKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRY
RRDLLRLSYGEAKKAARDYETAKNYFKKSLKDMGYGNWISKPQEEKNFYLCPV
NT seq 4122 nt   +upstreamnt  +downstreamnt
atgcaagggtggggttcgacttgcaaccggtgtgaaaccaagcgctggcgcaaggtttgc
tcaaacccctcctcttggccaaactttccagaggggaaggccttccgaggaaacgaaagc
gaaattgaatcggagccatcttgggccccgcgcgcagaccgcggagtttcccgtgccgat
gcttccgggccacttccgttgcggaggagcgggagcgtgggggtctcgaggggctggtgc
ggggccagggtggtggtgctggcgggtagggccgggcaatgccttgcgggcaccatgaac
ccgcagcaggggcattccctcagtggatactacccctatccatttcaaggctatgagcac
agaaaggtcagacaccagcagcctgggccgggatcttcccccagtagtttccgacataag
caaatagagtttctcaagggccagctcccagaagcaccagtgattggaaagcagacaccg
tcactgtcaccttccctcccaggactctggccaaggtttccagcactacctgtctacagt
accggattcaggaaagaggagatctggggtgtccccaggagcgtgcattttggaaggcag
gggctccaaagagcattccagcatccttcaccacgtggtaggattctgccacagagaggt
gtcgattgcctttcctcagatttccaggaactgaatatcaaccaggatcaggaacaaagg
atcttaaagctcttgaaagagcttggagaagggaaggccaccacagtacatgatctgtct
gggaaacttagggccccaaagaaggaaatcaatcgagttttatactccctggcaaagaag
ggcaagctacagaaggaggcaggaataccccctttgtggaaaatctcggcctcagctcag
gctcggaaccagcacagcagagcagtgagaccagacggtcatagcaagggagccccaaac
tcagacccgagtttggaacctgaagacagaaactccacgtctgtctcagaagattttact
gagccttttatcacagtctcagctcaggctcggaaccagctcagcagagcggtgagacca
gacggtcatagccagggagccccaaactcagacccgagtttagaacctgaagacagaaac
tccacgtctgtctcagaagattttactgagccttttatcacagtctcagctcaggctcgg
aaccagcacagcagagcagtgagaccagacggtcatagccagggagccccaaactcagaa
ccgagtttggaacctgaagacggaaactccacatctgccttagaagatcctcttgagctt
tttgacatggctgagatcaaggagaaaatctgtgactatctcttcaatgtgtctgactcc
tctgccctgaatttggctaaaaatattggcctctccaaggcccgagatataaatgctgtg
ctgattgacttggaaaggcagggggatgtcagtagacaagggacaacccctcccatgtgg
catttgacagacaagaagcgagagaggatgcaaattaagagaaacgtgaacagtgttctt
gaaacagctccgtctgcaatccctgagattcaaaggcacgcagagttccccacctgtaat
ttacccacgtcaaatgcctcaaataacatggtaaccacagaaaaagtggagaatgggcag
gaacctgtcgtaaagttagaaaacaggcaagagaccagaccagagccagtaagactgaaa
ccacctgttcataacaatggcccctcaagagcagggtatgttgactttgaaaatggccag
tgggccacagatgacatcccagatgacttgaatagtatccgcgcagcaccaggtgagttt
cgagccatcatggagatgccgtccttctacagtcacggcctgccacggtgttcaccctac
aagaaactgacagagtgccagctgaagaaccccatcagtgggctgttagaatatgctcag
ttcgctagtcaaacctgtgagttcaacctgatagagcagagtggaccaccccatgaacct
cgatttaaattccaggttgttatcaatggccgagagtttcccccagctgaagctggaagc
aagaaagtggccaagcaggatgcagctatgaaagccatgacaattctgctagaggaagcc
aaagccaaggacagtggaaaatcagaagaatcatcccactattctacagagaaagagtca
gagaagaccgcagagtcccagccctccgccccttcagccacacccttcttttctgggaag
agccccgtcaccacgctgcttgagtgtatgcacaagctggggaactcctgtgaattccgg
ctcctttccaaagaaggccctgcccatgagcccaagtttgaatactgtgttcaagtggga
gcccagactttccccagtgtgagtgcccccagcaagaaagtggcaaagcagatggccgca
gaggaagccatgaaggccctgcatggggaggcgaccaactccatgctttctgatgaccag
cccgaaggtacaatctcagagtcacttgataacttggaatcgatgatgcccaacaaggtc
aggaggattggtgagctcgtgagatacttgaacaccaaccctgtgggtggccttttggag
tacgctcgctcccatggcttcgctgccgaattcaagttggtcgaccagtccggacctcct
cacgagcccaagtttgtttaccaagcaaaagttgggggtcgctggttcccggctgtctgc
gcacacagcaagaagcaaggcaagcaggaagcagcagatgcggctctccgtgtcttgatt
ggggagaacgagaaggcagaacgcatgggtttcgcagaggtaaccccagtgacaggggcc
actctcagaagaactatgctcctcctctcaaggtccccagaagcacagccaaagacactc
cctgtcaccggcagcaccttccatgaccagatagccatgctgagccaccgatgcttcaac
actctaaccaacagcctccagccctccttgctcggccgcaagattctggcagccatcgtt
atgaagaaagactctgaggacatgggtgtggttgtcagcttgggaacagggaatcgctgt
gtgaaaggagattctctcagcctaaagggagaaactgtcaacgactgtcatgcagaaatc
atctcccggagaggcttcatcaggtttctctacagtgagttaatgaaatacaacccccaa
actgcaaaggatagcatatttgagcctgctaagggaggaggaaagctccaaatcaaaaag
actgtgtcattccatctctatatcagcaccgctccgtgtggagatggtgccctctttgac
aagtcctgcagcgaccgtgccatggaaaacaccgactcccgccactaccctgtctttgag
aaccccaaacaaggcaagctccgcaccaaggtggagaacggagaaggcacaatccctgtg
gaatccagtgacattgtgcctacgtgggacggcattcggcttggagagaggctccgtacc
atgtcctgtagtgacaaaatcctacgctggaatgtgctaggcctgcaaggggcattgttg
acccacttcctgcagcccatttatctcaaatctgtcacattgggttaccttttcagccaa
gggcatctgacccgtgctatttgctgtcgtatggcaagagacgggagtgcatttgaggat
ggactgcgacatccctttattgtcaaccaccccaaggttggcagagtcagcgtatatgat
tccaaaaggcagtcagggaagactaaggagacaagcgtcaactggtgtctggctgatggc
tacgacctggagatcctggacggcaccagaggcaccgtggacgggccacggaatgaattg
tcccgggtctccaaaaagaacatttttcttctgtttaagaagctctgctccttccgttac
cgcagggatctactgagactctcctatggtgaggccaagaaagctgcccgtgactacgag
acggccaagaactacttcaaaaaaagcctgaaggatatgggctatgggaactggattagc
aaaccccaggaggagaagaacttttatctctgcccagtatag

DBGET integrated database retrieval system